BLASTX nr result
ID: Ephedra25_contig00010406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00010406 (816 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK24618.1| unknown [Picea sitchensis] 63 1e-07 ref|XP_004144256.1| PREDICTED: F-box protein SKP2A-like [Cucumis... 57 8e-06 >gb|ABK24618.1| unknown [Picea sitchensis] Length = 438 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +2 Query: 2 MELLLRILKTIDERTLVRAADVCTSWRLAICFGVQELSLSW 124 MELL+RIL+ +D+RT++ + VCT WR AIC GVQELSLSW Sbjct: 53 MELLMRILRLVDDRTVIIGSGVCTGWREAICIGVQELSLSW 93 >ref|XP_004144256.1| PREDICTED: F-box protein SKP2A-like [Cucumis sativus] gi|449517068|ref|XP_004165568.1| PREDICTED: F-box protein SKP2A-like [Cucumis sativus] Length = 376 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 2 MELLLRILKTIDERTLVRAADVCTSWRLAICFGVQELSLSW 124 MELLL+IL +D+RT++ A+ VC WR AICFG+ LSLSW Sbjct: 50 MELLLQILSLVDDRTVIVASGVCRGWRDAICFGLAHLSLSW 90