BLASTX nr result
ID: Ephedra25_contig00010206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00010206 (578 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006287170.1| hypothetical protein CARUB_v10000355mg [Caps... 57 3e-06 gb|AAF24126.1|AF121673_1 soluble starch synthase [Arabidopsis th... 56 8e-06 ref|NP_197818.1| starch synthase 1 [Arabidopsis thaliana] gi|334... 56 8e-06 ref|XP_002872103.1| hypothetical protein ARALYDRAFT_489289 [Arab... 56 8e-06 >ref|XP_006287170.1| hypothetical protein CARUB_v10000355mg [Capsella rubella] gi|482555876|gb|EOA20068.1| hypothetical protein CARUB_v10000355mg [Capsella rubella] Length = 697 Score = 57.4 bits (137), Expect = 3e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 576 GMLQNFSWENAASQYEQIFEWVMIDPPYVA 487 GM QN+SWENAA QYEQ+F+WV +DPPYV+ Sbjct: 668 GMTQNYSWENAAVQYEQVFQWVFMDPPYVS 697 >gb|AAF24126.1|AF121673_1 soluble starch synthase [Arabidopsis thaliana] Length = 575 Score = 55.8 bits (133), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -3 Query: 576 GMLQNFSWENAASQYEQIFEWVMIDPPYVA 487 GM +N+SWENAA QYEQ+F+WV +DPPYV+ Sbjct: 546 GMTRNYSWENAAVQYEQVFQWVFMDPPYVS 575 >ref|NP_197818.1| starch synthase 1 [Arabidopsis thaliana] gi|334187896|ref|NP_001190378.1| starch synthase 1 [Arabidopsis thaliana] gi|29337131|sp|Q9FNF2.1|SSY1_ARATH RecName: Full=Starch synthase 1, chloroplastic/amyloplastic; Short=AtSS1; Short=SSS; AltName: Full=Soluble starch synthase I; Flags: Precursor gi|10177090|dbj|BAB10396.1| soluble starch synthase [Arabidopsis thaliana] gi|22135791|gb|AAM91082.1| AT5g24300/MOP9_12 [Arabidopsis thaliana] gi|110742056|dbj|BAE98960.1| soluble starch synthase [Arabidopsis thaliana] gi|332005899|gb|AED93282.1| starch synthase 1 [Arabidopsis thaliana] gi|332005900|gb|AED93283.1| starch synthase 1 [Arabidopsis thaliana] Length = 652 Score = 55.8 bits (133), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -3 Query: 576 GMLQNFSWENAASQYEQIFEWVMIDPPYVA 487 GM +N+SWENAA QYEQ+F+WV +DPPYV+ Sbjct: 623 GMTRNYSWENAAVQYEQVFQWVFMDPPYVS 652 >ref|XP_002872103.1| hypothetical protein ARALYDRAFT_489289 [Arabidopsis lyrata subsp. lyrata] gi|297317940|gb|EFH48362.1| hypothetical protein ARALYDRAFT_489289 [Arabidopsis lyrata subsp. lyrata] Length = 655 Score = 55.8 bits (133), Expect = 8e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -3 Query: 576 GMLQNFSWENAASQYEQIFEWVMIDPPYVA 487 GM +N+SWENAA QYEQ+F+WV +DPPYV+ Sbjct: 626 GMTRNYSWENAAVQYEQVFQWVFMDPPYVS 655