BLASTX nr result
ID: Ephedra25_contig00010030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00010030 (463 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK24805.1| unknown [Picea sitchensis] 74 3e-11 ref|XP_004300625.1| PREDICTED: acidic leucine-rich nuclear phosp... 65 7e-09 gb|EXB59112.1| Acidic leucine-rich nuclear phosphoprotein 32-rel... 63 4e-08 ref|XP_006411977.1| hypothetical protein EUTSA_v10025306mg [Eutr... 63 4e-08 gb|EOX91135.1| Leucine-rich repeat family protein isoform 3 [The... 63 4e-08 gb|EOX91133.1| Leucine-rich repeat family protein isoform 1 [The... 63 4e-08 ref|XP_003518034.1| PREDICTED: acidic leucine-rich nuclear phosp... 63 4e-08 gb|ESW28026.1| hypothetical protein PHAVU_003G252700g [Phaseolus... 63 5e-08 gb|AFK47183.1| unknown [Medicago truncatula] 63 5e-08 ref|XP_003547991.1| PREDICTED: acidic leucine-rich nuclear phosp... 63 5e-08 ref|XP_003629472.1| Acidic leucine-rich nuclear phosphoprotein 3... 63 5e-08 ref|NP_001169648.1| hypothetical protein [Zea mays] gi|224030627... 62 6e-08 ref|NP_190638.1| leucine-rich repeat (LRR) family protein [Arabi... 62 6e-08 ref|XP_004509248.1| PREDICTED: acidic leucine-rich nuclear phosp... 62 8e-08 gb|EMT13238.1| Acidic leucine-rich nuclear phosphoprotein 32-rel... 62 8e-08 gb|EMS51802.1| Acidic leucine-rich nuclear phosphoprotein 32-rel... 62 8e-08 ref|XP_004234560.1| PREDICTED: acidic leucine-rich nuclear phosp... 62 8e-08 dbj|BAK05784.1| predicted protein [Hordeum vulgare subsp. vulgar... 62 8e-08 ref|XP_002973808.1| hypothetical protein SELMODRAFT_442226 [Sela... 62 8e-08 ref|XP_004958257.1| PREDICTED: acidic leucine-rich nuclear phosp... 61 1e-07 >gb|ABK24805.1| unknown [Picea sitchensis] Length = 421 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMD 350 QFNL SLDLYECPVTRLPEYRARVFDIIK+L+FLDK D Sbjct: 117 QFNLVSLDLYECPVTRLPEYRARVFDIIKSLEFLDKTD 154 >ref|XP_004300625.1| PREDICTED: acidic leucine-rich nuclear phosphoprotein 32-related protein-like [Fragaria vesca subsp. vesca] Length = 468 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q LTSLDLYECPVTR+ +YR+RVF +IK+LK+LDKMDA Sbjct: 118 QLKLTSLDLYECPVTRIKDYRSRVFGLIKSLKYLDKMDA 156 >gb|EXB59112.1| Acidic leucine-rich nuclear phosphoprotein 32-related protein [Morus notabilis] Length = 461 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF +IK+LK+LDKMDA Sbjct: 118 QLKLVSLDLYECPVTRVKDYRSRVFGLIKSLKYLDKMDA 156 >ref|XP_006411977.1| hypothetical protein EUTSA_v10025306mg [Eutrema salsugineum] gi|557113147|gb|ESQ53430.1| hypothetical protein EUTSA_v10025306mg [Eutrema salsugineum] Length = 420 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF ++K+LK+LDKMDA Sbjct: 118 QLKLVSLDLYECPVTRMKDYRSRVFGLVKSLKYLDKMDA 156 >gb|EOX91135.1| Leucine-rich repeat family protein isoform 3 [Theobroma cacao] Length = 461 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF +IK+LK+LDKMDA Sbjct: 118 QLKLVSLDLYECPVTRVKDYRSRVFGLIKSLKYLDKMDA 156 >gb|EOX91133.1| Leucine-rich repeat family protein isoform 1 [Theobroma cacao] gi|508699238|gb|EOX91134.1| Leucine-rich repeat family protein isoform 1 [Theobroma cacao] Length = 457 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF +IK+LK+LDKMDA Sbjct: 118 QLKLVSLDLYECPVTRVKDYRSRVFGLIKSLKYLDKMDA 156 >ref|XP_003518034.1| PREDICTED: acidic leucine-rich nuclear phosphoprotein 32-related protein-like [Glycine max] Length = 464 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF +IK+LK+LDKMDA Sbjct: 126 QLKLVSLDLYECPVTRVKDYRSRVFGLIKSLKYLDKMDA 164 >gb|ESW28026.1| hypothetical protein PHAVU_003G252700g [Phaseolus vulgaris] Length = 458 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF +IK+LK+LDKMDA Sbjct: 126 QVKLVSLDLYECPVTRVKDYRSRVFGLIKSLKYLDKMDA 164 >gb|AFK47183.1| unknown [Medicago truncatula] Length = 219 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF +IK+LK+LDKMDA Sbjct: 126 QVKLVSLDLYECPVTRVKDYRSRVFGLIKSLKYLDKMDA 164 >ref|XP_003547991.1| PREDICTED: acidic leucine-rich nuclear phosphoprotein 32-related protein-like [Glycine max] Length = 462 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF +IK+LK+LDKMDA Sbjct: 126 QVKLVSLDLYECPVTRVKDYRSRVFGLIKSLKYLDKMDA 164 >ref|XP_003629472.1| Acidic leucine-rich nuclear phosphoprotein 32-related protein [Medicago truncatula] gi|355523494|gb|AET03948.1| Acidic leucine-rich nuclear phosphoprotein 32-related protein [Medicago truncatula] Length = 476 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF +IK+LK+LDKMDA Sbjct: 118 QVKLVSLDLYECPVTRVKDYRSRVFGLIKSLKYLDKMDA 156 >ref|NP_001169648.1| hypothetical protein [Zea mays] gi|224030627|gb|ACN34389.1| unknown [Zea mays] gi|414887540|tpg|DAA63554.1| TPA: hypothetical protein ZEAMMB73_588339 [Zea mays] gi|414887541|tpg|DAA63555.1| TPA: hypothetical protein ZEAMMB73_588339 [Zea mays] Length = 483 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 454 LTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 L SLDLYECPVTR+ +YR+RVF++I+TLK+LDKMDA Sbjct: 124 LVSLDLYECPVTRVKDYRSRVFEMIRTLKYLDKMDA 159 >ref|NP_190638.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana] gi|75337056|sp|Q9SCQ7.1|AN32_ARATH RecName: Full=Acidic leucine-rich nuclear phosphoprotein 32-related protein; AltName: Full=ANP32/acidic nuclear phosphoprotein-like protein gi|6561972|emb|CAB62438.1| putative protein [Arabidopsis thaliana] gi|332645176|gb|AEE78697.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana] Length = 447 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 + L SLDLYECPVTRL +YR+RVF +IKTLK+LDK DA Sbjct: 118 ELKLVSLDLYECPVTRLKDYRSRVFGLIKTLKYLDKTDA 156 >ref|XP_004509248.1| PREDICTED: acidic leucine-rich nuclear phosphoprotein 32-related protein-like isoform X1 [Cicer arietinum] Length = 482 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 Q L SLDLYECPVTR+ +YR+RVF +IK++K+LDKMDA Sbjct: 126 QLKLVSLDLYECPVTRVKDYRSRVFGLIKSVKYLDKMDA 164 >gb|EMT13238.1| Acidic leucine-rich nuclear phosphoprotein 32-related protein 1 [Aegilops tauschii] Length = 478 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 + L SLDLYECPVTR+ +YR+RVF +I+TLK+LDKMDA Sbjct: 120 RLRLVSLDLYECPVTRVKDYRSRVFGLIRTLKYLDKMDA 158 >gb|EMS51802.1| Acidic leucine-rich nuclear phosphoprotein 32-related protein 1 [Triticum urartu] Length = 575 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 + L SLDLYECPVTR+ +YR+RVF +I+TLK+LDKMDA Sbjct: 236 RLRLVSLDLYECPVTRVKDYRSRVFGLIRTLKYLDKMDA 274 >ref|XP_004234560.1| PREDICTED: acidic leucine-rich nuclear phosphoprotein 32-related protein-like [Solanum lycopersicum] Length = 463 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 + L SLDLYECPVTR+ +YR+RVF +I++LKFLDKMDA Sbjct: 118 ELRLVSLDLYECPVTRVKDYRSRVFGLIRSLKFLDKMDA 156 >dbj|BAK05784.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326523731|dbj|BAJ93036.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 481 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 + L SLDLYECPVTR+ +YR+RVF +I+TLK+LDKMDA Sbjct: 120 RLRLVSLDLYECPVTRVKDYRSRVFGLIRTLKYLDKMDA 158 >ref|XP_002973808.1| hypothetical protein SELMODRAFT_442226 [Selaginella moellendorffii] gi|300158140|gb|EFJ24763.1| hypothetical protein SELMODRAFT_442226 [Selaginella moellendorffii] Length = 474 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 463 QFNLTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 + L SLDLYECPVT++P YRA+VF +IKTLK+LDK+DA Sbjct: 117 RLRLVSLDLYECPVTKVPNYRAQVFGMIKTLKYLDKVDA 155 >ref|XP_004958257.1| PREDICTED: acidic leucine-rich nuclear phosphoprotein 32-related protein 1-like [Setaria italica] Length = 486 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 454 LTSLDLYECPVTRLPEYRARVFDIIKTLKFLDKMDA 347 L SLDLYECPVTR+ +YR+RVF +I+TLK+LDKMDA Sbjct: 124 LVSLDLYECPVTRVKDYRSRVFGMIRTLKYLDKMDA 159