BLASTX nr result
ID: Ephedra25_contig00009656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00009656 (510 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGM34023.1| class III homeodomain leucine zipper protein 33 [... 166 4e-58 gb|ABD75307.1| class III homeodomain-leucine zipper protein C3HD... 163 6e-58 gb|ABG73251.1| class III HD-Zip protein HDZ32 [Ginkgo biloba] 163 6e-58 gb|ABD90528.1| class III homeodomain-leucine zipper [Pseudotsuga... 164 3e-57 gb|ABD75310.1| class III homeodomain-leucine zipper protein C3HD... 164 3e-57 gb|ABD75312.1| class III homeodomain-leucine zipper protein C3HD... 159 4e-57 gb|ABG73246.1| class III HD-Zip protein HDZ32 [Pinus taeda] 162 5e-57 gb|ABD75308.1| class III homeodomain-leucine zipper protein C3HD... 160 9e-57 gb|ABG73252.1| class III HD-Zip protein HDZ33 [Ginkgo biloba] 160 9e-57 gb|ABD75309.1| class III homeodomain-leucine zipper protein C3HD... 155 1e-56 gb|ABD90527.1| class III homeodomain-leucine zipper [Pseudotsuga... 155 1e-56 gb|ADV04322.1| class III homeodomain leucine zipper protein [Pic... 155 3e-56 gb|ABB93543.1| homeodomain-leucine zipper trancription factor HB... 155 3e-56 gb|ABB93495.1| homeodomain-leucine zipper trancription factor HB... 155 3e-56 gb|ABB94031.1| homeodomain-leucine zipper trancription factor HB... 155 3e-56 gb|ABB93496.1| homeodomain-leucine zipper trancription factor HB... 155 3e-56 gb|ABG73247.1| class III HD-Zip protein HDZ33 [Pinus taeda] 167 3e-56 gb|ADE76969.1| unknown [Picea sitchensis] 155 3e-56 gb|ADV04324.1| class III homeodomain leucine zipper protein [Pic... 159 6e-56 gb|ABD75306.1| class III homeodomain-leucine zipper protein C3HD... 156 6e-56 >gb|AGM34023.1| class III homeodomain leucine zipper protein 33 [Larix kaempferi] Length = 840 Score = 166 bits (419), Expect(2) = 4e-58 Identities = 78/97 (80%), Positives = 92/97 (94%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT+EEALLSKDMFLLQLC+G+DE+A G C+QL+FAPIDA+F+ Sbjct: 520 HTVEHEEFLEVIKLEGHGLTHEEALLSKDMFLLQLCNGIDEHAAGFCAQLVFAPIDASFA 579 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ESG DA+ PNRTLDLAS+LE+G Sbjct: 580 DDAPLLPSGFRVIPLESGSDASPPNRTLDLASALEVG 616 Score = 85.1 bits (209), Expect(2) = 4e-58 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQ-HSSQLGMRSLPGAPEAGTLARWICQ 18 YQ H++++VAAMA QYVR VIASVQRV++AL+P S LG R PG PEA TL RWICQ Sbjct: 645 YQTHVRDNVAAMARQYVRHVIASVQRVSIALAPSLQSPHLGPRLPPGTPEALTLTRWICQ 704 Query: 17 SYRIH 3 SYR+H Sbjct: 705 SYRMH 709 >gb|ABD75307.1| class III homeodomain-leucine zipper protein C3HDZ2 [Ginkgo biloba] Length = 843 Score = 163 bits (412), Expect(2) = 6e-58 Identities = 77/98 (78%), Positives = 93/98 (94%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE +GLT EEALLS++MFLLQLCSGVDENA G+C++L+FAPIDA+F+ Sbjct: 523 HTVEHEEFLEVIKLEGNGLTQEEALLSREMFLLQLCSGVDENAVGACAELVFAPIDASFA 582 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIGP 217 D+APLLPSGFR+IP++SG D +SPNRTLDLAS+LEIGP Sbjct: 583 DNAPLLPSGFRVIPLDSGVDGSSPNRTLDLASALEIGP 620 Score = 87.0 bits (214), Expect(2) = 6e-58 Identities = 44/65 (67%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VA+MA QYVR V+ASVQRVAMAL+P SS LG R PG PEA TLARWIC Sbjct: 648 YENHLRENVASMARQYVRSVVASVQRVAMALAPSRLSSHLGPRPPPGTPEALTLARWICH 707 Query: 17 SYRIH 3 SYR H Sbjct: 708 SYRFH 712 >gb|ABG73251.1| class III HD-Zip protein HDZ32 [Ginkgo biloba] Length = 779 Score = 163 bits (412), Expect(2) = 6e-58 Identities = 77/98 (78%), Positives = 93/98 (94%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE +GLT EEALLS++MFLLQLCSGVDENA G+C++L+FAPIDA+F+ Sbjct: 459 HTVEHEEFLEVIKLEGNGLTQEEALLSREMFLLQLCSGVDENAVGACAELVFAPIDASFA 518 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIGP 217 D+APLLPSGFR+IP++SG D +SPNRTLDLAS+LEIGP Sbjct: 519 DNAPLLPSGFRVIPLDSGVDGSSPNRTLDLASALEIGP 556 Score = 87.0 bits (214), Expect(2) = 6e-58 Identities = 44/65 (67%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VA+MA QYVR V+ASVQRVAMAL+P SS LG R PG PEA TLARWIC Sbjct: 584 YEDHLRENVASMARQYVRSVVASVQRVAMALAPSRLSSHLGPRPPPGTPEALTLARWICH 643 Query: 17 SYRIH 3 SYR H Sbjct: 644 SYRFH 648 >gb|ABD90528.1| class III homeodomain-leucine zipper [Pseudotsuga menziesii] Length = 840 Score = 164 bits (415), Expect(2) = 3e-57 Identities = 78/97 (80%), Positives = 89/97 (91%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT+EEALLSKDMFLLQLCSG+DE A G C+QL FAPIDA+F+ Sbjct: 520 HTVEHEEFLEVIKLEGHGLTHEEALLSKDMFLLQLCSGIDEQAAGFCAQLAFAPIDASFA 579 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ESG D + PNRTLDLAS+LE+G Sbjct: 580 DDAPLLPSGFRVIPLESGSDTSPPNRTLDLASALEVG 616 Score = 83.6 bits (205), Expect(2) = 3e-57 Identities = 42/65 (64%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQ-HSSQLGMRSLPGAPEAGTLARWICQ 18 YQ H++++VA+MA QYVR VIASVQRV++AL+P S LG R PG PEA TL RWICQ Sbjct: 645 YQNHVRDNVASMARQYVRHVIASVQRVSVALAPSLQSPHLGPRPPPGTPEALTLTRWICQ 704 Query: 17 SYRIH 3 SYR+H Sbjct: 705 SYRMH 709 >gb|ABD75310.1| class III homeodomain-leucine zipper protein C3HDZ2 [Pseudotsuga menziesii] Length = 839 Score = 164 bits (415), Expect(2) = 3e-57 Identities = 78/97 (80%), Positives = 89/97 (91%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT+EEALLSKDMFLLQLCSG+DE A G C+QL FAPIDA+F+ Sbjct: 520 HTVEHEEFLEVIKLEGHGLTHEEALLSKDMFLLQLCSGIDEQAAGFCAQLAFAPIDASFA 579 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ESG D + PNRTLDLAS+LE+G Sbjct: 580 DDAPLLPSGFRVIPLESGSDTSPPNRTLDLASALEVG 616 Score = 83.6 bits (205), Expect(2) = 3e-57 Identities = 42/65 (64%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQ-HSSQLGMRSLPGAPEAGTLARWICQ 18 YQ H++++VA+MA QYVR VIASVQRV++AL+P S LG R PG PEA TL RWICQ Sbjct: 644 YQNHVRDNVASMARQYVRHVIASVQRVSVALAPSLQSPHLGPRPPPGTPEALTLTRWICQ 703 Query: 17 SYRIH 3 SYR+H Sbjct: 704 SYRMH 708 >gb|ABD75312.1| class III homeodomain-leucine zipper protein C3HDZ2 [Taxus globosa] Length = 843 Score = 159 bits (403), Expect(2) = 4e-57 Identities = 74/98 (75%), Positives = 92/98 (93%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE +GLT EEALLS+DMFLLQLCSG+DENA G+C++L+FAPIDA+ + Sbjct: 523 HTVEHEEFLEVIKLECNGLTQEEALLSRDMFLLQLCSGIDENAVGACAELVFAPIDASLT 582 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIGP 217 D APLLPSGFR+IP++SG D++SPNRTLDLAS+L++GP Sbjct: 583 DSAPLLPSGFRVIPLDSGIDSSSPNRTLDLASALDVGP 620 Score = 87.8 bits (216), Expect(2) = 4e-57 Identities = 44/65 (67%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VA+MA QYVR V+ASVQRVAMAL+P S LG R PG PEA TLARWICQ Sbjct: 648 YENHLRENVASMARQYVRNVVASVQRVAMALAPSRLGSHLGPRPPPGTPEALTLARWICQ 707 Query: 17 SYRIH 3 SYR H Sbjct: 708 SYRFH 712 >gb|ABG73246.1| class III HD-Zip protein HDZ32 [Pinus taeda] Length = 844 Score = 162 bits (410), Expect(2) = 5e-57 Identities = 76/97 (78%), Positives = 90/97 (92%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEALLS+DMFLLQLCSG+DENA G+C++L+FAPIDA+ + Sbjct: 524 HTVEHEEFLEVIKLENHGLTQEEALLSRDMFLLQLCSGLDENAVGACAELVFAPIDASLA 583 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIG 220 D +PLLPSGFR+IP++SG D +SPNRTLDLASSLEIG Sbjct: 584 DSSPLLPSGFRVIPLDSGMDGSSPNRTLDLASSLEIG 620 Score = 84.7 bits (208), Expect(2) = 5e-57 Identities = 42/65 (64%), Positives = 51/65 (78%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 ++ H++E+VA+MA QYVR V+ASVQRVAMAL+P S LG R PG PEA TLARW+CQ Sbjct: 649 FENHLRENVASMARQYVRGVVASVQRVAMALAPSRLGSHLGPRLPPGTPEALTLARWVCQ 708 Query: 17 SYRIH 3 SYR H Sbjct: 709 SYRFH 713 >gb|ABD75308.1| class III homeodomain-leucine zipper protein C3HDZ3 [Ginkgo biloba] Length = 837 Score = 160 bits (406), Expect(2) = 9e-57 Identities = 73/97 (75%), Positives = 91/97 (93%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HT+E+EEFLEVIKLE HGLT+EE +LS+DMFLLQLCSG+DENA G C+QL+FAPIDA+F+ Sbjct: 518 HTMEHEEFLEVIKLEGHGLTHEETVLSRDMFLLQLCSGIDENAVGCCAQLVFAPIDASFA 577 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP++SG D ++PNRTLDLAS+L++G Sbjct: 578 DDAPLLPSGFRVIPLDSGTDGSTPNRTLDLASALDVG 614 Score = 85.5 bits (210), Expect(2) = 9e-57 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSP-QHSSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++++VAAMA QYVR V+ASVQRVAMAL+P + S+ LG R PG PEA TLA WICQ Sbjct: 642 YETHLRDNVAAMARQYVRSVVASVQRVAMALAPSRQSTLLGPRPPPGTPEALTLAGWICQ 701 Query: 17 SYRIH 3 SYR H Sbjct: 702 SYRFH 706 >gb|ABG73252.1| class III HD-Zip protein HDZ33 [Ginkgo biloba] Length = 776 Score = 160 bits (406), Expect(2) = 9e-57 Identities = 73/97 (75%), Positives = 91/97 (93%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HT+E+EEFLEVIKLE HGLT+EE +LS+DMFLLQLCSG+DENA G C+QL+FAPIDA+F+ Sbjct: 456 HTMEHEEFLEVIKLEGHGLTHEETVLSRDMFLLQLCSGIDENAVGCCAQLVFAPIDASFA 515 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP++SG D ++PNRTLDLAS+L++G Sbjct: 516 DDAPLLPSGFRVIPLDSGTDGSTPNRTLDLASALDVG 552 Score = 85.5 bits (210), Expect(2) = 9e-57 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSP-QHSSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++++VAAMA QYVR V+ASVQRVAMAL+P + S+ LG R PG PEA TLA WICQ Sbjct: 581 YETHLRDNVAAMARQYVRSVVASVQRVAMALAPSRQSTLLGPRPPPGTPEALTLAGWICQ 640 Query: 17 SYRIH 3 SYR H Sbjct: 641 SYRFH 645 >gb|ABD75309.1| class III homeodomain-leucine zipper protein C3HDZ1 [Pseudotsuga menziesii] Length = 842 Score = 155 bits (392), Expect(2) = 1e-56 Identities = 75/98 (76%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEA+LS+DMFLLQLCSG+DENA G+C++L+FAPID +F+ Sbjct: 522 HTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVFAPIDESFA 581 Query: 330 DDAPLLPSGFRIIPMESGQD-AASPNRTLDLASSLEIG 220 DDAPLLPSGFRIIP+ES D + PNRTLDLAS+LE+G Sbjct: 582 DDAPLLPSGFRIIPLESRTDGSGGPNRTLDLASALEVG 619 Score = 90.5 bits (223), Expect(2) = 1e-56 Identities = 45/65 (69%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VAAMA QYVR V+ASVQRVAMAL+P SS +G R PG PEA TLARWICQ Sbjct: 647 YESHLRENVAAMARQYVRTVVASVQRVAMALAPSRLSSHVGPRPPPGTPEALTLARWICQ 706 Query: 17 SYRIH 3 SYR+H Sbjct: 707 SYRLH 711 >gb|ABD90527.1| class III homeodomain-leucine zipper [Pseudotsuga menziesii] Length = 842 Score = 155 bits (391), Expect(2) = 1e-56 Identities = 74/98 (75%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEA+LS+DMFLLQLCSG+DENA G+C++L+FAPID +F+ Sbjct: 522 HTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVFAPIDESFA 581 Query: 330 DDAPLLPSGFRIIPMESGQD-AASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ES D + PNRTLDLAS+LE+G Sbjct: 582 DDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVG 619 Score = 90.5 bits (223), Expect(2) = 1e-56 Identities = 45/65 (69%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VAAMA QYVR V+ASVQRVAMAL+P SS +G R PG PEA TLARWICQ Sbjct: 647 YESHLRENVAAMARQYVRTVVASVQRVAMALAPSRLSSHVGPRPPPGTPEALTLARWICQ 706 Query: 17 SYRIH 3 SYR+H Sbjct: 707 SYRLH 711 >gb|ADV04322.1| class III homeodomain leucine zipper protein [Picea glauca] Length = 842 Score = 155 bits (391), Expect(2) = 3e-56 Identities = 74/98 (75%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEA+LS+DMFLLQLCSG+DENA G+C++L+FAPID +F+ Sbjct: 522 HTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVFAPIDESFA 581 Query: 330 DDAPLLPSGFRIIPMESGQD-AASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ES D + PNRTLDLAS+LE+G Sbjct: 582 DDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVG 619 Score = 89.4 bits (220), Expect(2) = 3e-56 Identities = 44/65 (67%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VAAMA QYVR V+ASVQRVAMAL+P S+ +G R PG PEA TLARWICQ Sbjct: 647 YESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGPRPPPGTPEALTLARWICQ 706 Query: 17 SYRIH 3 SYR+H Sbjct: 707 SYRLH 711 >gb|ABB93543.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908758|gb|ABB93549.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908766|gb|ABB93553.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908776|gb|ABB93558.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908792|gb|ABB93566.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908814|gb|ABB93577.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908824|gb|ABB93582.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908842|gb|ABB93591.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] Length = 842 Score = 155 bits (391), Expect(2) = 3e-56 Identities = 74/98 (75%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEA+LS+DMFLLQLCSG+DENA G+C++L+FAPID +F+ Sbjct: 522 HTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVFAPIDESFA 581 Query: 330 DDAPLLPSGFRIIPMESGQD-AASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ES D + PNRTLDLAS+LE+G Sbjct: 582 DDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVG 619 Score = 89.4 bits (220), Expect(2) = 3e-56 Identities = 44/65 (67%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VAAMA QYVR V+ASVQRVAMAL+P S+ +G R PG PEA TLARWICQ Sbjct: 647 YESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGPRPPPGTPEALTLARWICQ 706 Query: 17 SYRIH 3 SYR+H Sbjct: 707 SYRLH 711 >gb|ABB93495.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908654|gb|ABB93497.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908656|gb|ABB93498.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908658|gb|ABB93499.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908660|gb|ABB93500.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908662|gb|ABB93501.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908664|gb|ABB93502.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908666|gb|ABB93503.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908668|gb|ABB93504.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908670|gb|ABB93505.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908672|gb|ABB93506.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908674|gb|ABB93507.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908676|gb|ABB93508.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908678|gb|ABB93509.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908680|gb|ABB93510.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908682|gb|ABB93511.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908684|gb|ABB93512.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908686|gb|ABB93513.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908688|gb|ABB93514.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908690|gb|ABB93515.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908692|gb|ABB93516.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908694|gb|ABB93517.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908696|gb|ABB93518.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908698|gb|ABB93519.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908700|gb|ABB93520.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908702|gb|ABB93521.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908704|gb|ABB93522.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908706|gb|ABB93523.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908708|gb|ABB93524.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908710|gb|ABB93525.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908712|gb|ABB93526.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908714|gb|ABB93527.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908716|gb|ABB93528.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908718|gb|ABB93529.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908720|gb|ABB93530.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908722|gb|ABB93531.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908724|gb|ABB93532.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908726|gb|ABB93533.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908728|gb|ABB93534.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908730|gb|ABB93535.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908732|gb|ABB93536.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908734|gb|ABB93537.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908736|gb|ABB93538.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908738|gb|ABB93539.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908740|gb|ABB93540.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] gi|82908742|gb|ABB93541.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908744|gb|ABB93542.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908748|gb|ABB93544.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908750|gb|ABB93545.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908752|gb|ABB93546.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908754|gb|ABB93547.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908756|gb|ABB93548.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908760|gb|ABB93550.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908762|gb|ABB93551.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908764|gb|ABB93552.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908768|gb|ABB93554.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908770|gb|ABB93555.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908772|gb|ABB93556.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908774|gb|ABB93557.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908778|gb|ABB93559.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908780|gb|ABB93560.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908782|gb|ABB93561.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908784|gb|ABB93562.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908786|gb|ABB93563.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908788|gb|ABB93564.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908790|gb|ABB93565.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908794|gb|ABB93567.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908796|gb|ABB93568.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908798|gb|ABB93569.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908800|gb|ABB93570.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908802|gb|ABB93571.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908804|gb|ABB93572.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908806|gb|ABB93573.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908808|gb|ABB93574.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908810|gb|ABB93575.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908812|gb|ABB93576.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908816|gb|ABB93578.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908818|gb|ABB93579.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908820|gb|ABB93580.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908822|gb|ABB93581.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908826|gb|ABB93583.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908828|gb|ABB93584.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908830|gb|ABB93585.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908832|gb|ABB93586.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908834|gb|ABB93587.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908836|gb|ABB93588.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908838|gb|ABB93589.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908840|gb|ABB93590.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82908844|gb|ABB93592.1| homeodomain-leucine zipper trancription factor HB-3 [Picea mariana] gi|82909691|gb|ABB94009.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909693|gb|ABB94010.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909695|gb|ABB94011.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909697|gb|ABB94012.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909699|gb|ABB94013.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909701|gb|ABB94014.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909703|gb|ABB94015.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909705|gb|ABB94016.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909707|gb|ABB94017.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909709|gb|ABB94018.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909711|gb|ABB94019.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909713|gb|ABB94020.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909715|gb|ABB94021.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909717|gb|ABB94022.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909719|gb|ABB94023.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909721|gb|ABB94024.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909723|gb|ABB94025.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909725|gb|ABB94026.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909727|gb|ABB94027.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909729|gb|ABB94028.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909731|gb|ABB94029.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909733|gb|ABB94030.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909737|gb|ABB94032.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909739|gb|ABB94033.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909741|gb|ABB94034.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909743|gb|ABB94035.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909745|gb|ABB94036.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909747|gb|ABB94037.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909749|gb|ABB94038.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909751|gb|ABB94039.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909753|gb|ABB94040.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909755|gb|ABB94041.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909757|gb|ABB94042.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909759|gb|ABB94043.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909761|gb|ABB94044.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909763|gb|ABB94045.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909765|gb|ABB94046.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909767|gb|ABB94047.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909769|gb|ABB94048.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909771|gb|ABB94049.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909773|gb|ABB94050.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909775|gb|ABB94051.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909777|gb|ABB94052.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909779|gb|ABB94053.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909781|gb|ABB94054.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909783|gb|ABB94055.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909785|gb|ABB94056.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909787|gb|ABB94057.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909789|gb|ABB94058.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909791|gb|ABB94059.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909793|gb|ABB94060.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909795|gb|ABB94061.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909797|gb|ABB94062.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909799|gb|ABB94063.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909801|gb|ABB94064.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909803|gb|ABB94065.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909805|gb|ABB94066.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909807|gb|ABB94067.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909809|gb|ABB94068.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909811|gb|ABB94069.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909813|gb|ABB94070.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909815|gb|ABB94071.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909817|gb|ABB94072.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909819|gb|ABB94073.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909821|gb|ABB94074.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909823|gb|ABB94075.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909825|gb|ABB94076.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909827|gb|ABB94077.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909829|gb|ABB94078.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909831|gb|ABB94079.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909833|gb|ABB94080.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909835|gb|ABB94081.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909837|gb|ABB94082.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909839|gb|ABB94083.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909841|gb|ABB94084.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909843|gb|ABB94085.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909845|gb|ABB94086.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909847|gb|ABB94087.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909849|gb|ABB94088.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909851|gb|ABB94089.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909853|gb|ABB94090.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909855|gb|ABB94091.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909857|gb|ABB94092.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909859|gb|ABB94093.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909861|gb|ABB94094.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909863|gb|ABB94095.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909865|gb|ABB94096.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909867|gb|ABB94097.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909869|gb|ABB94098.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909873|gb|ABB94100.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909875|gb|ABB94101.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909877|gb|ABB94102.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909879|gb|ABB94103.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909881|gb|ABB94104.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909883|gb|ABB94105.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909885|gb|ABB94106.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909887|gb|ABB94107.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909889|gb|ABB94108.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909891|gb|ABB94109.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909893|gb|ABB94110.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909895|gb|ABB94111.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909897|gb|ABB94112.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909899|gb|ABB94113.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909901|gb|ABB94114.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909903|gb|ABB94115.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909905|gb|ABB94116.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909907|gb|ABB94117.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909909|gb|ABB94118.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909911|gb|ABB94119.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909913|gb|ABB94120.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909915|gb|ABB94121.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909917|gb|ABB94122.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909919|gb|ABB94123.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909921|gb|ABB94124.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909923|gb|ABB94125.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909925|gb|ABB94126.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909927|gb|ABB94127.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] gi|82909929|gb|ABB94128.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 155 bits (391), Expect(2) = 3e-56 Identities = 74/98 (75%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEA+LS+DMFLLQLCSG+DENA G+C++L+FAPID +F+ Sbjct: 522 HTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVFAPIDESFA 581 Query: 330 DDAPLLPSGFRIIPMESGQD-AASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ES D + PNRTLDLAS+LE+G Sbjct: 582 DDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVG 619 Score = 89.4 bits (220), Expect(2) = 3e-56 Identities = 44/65 (67%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VAAMA QYVR V+ASVQRVAMAL+P S+ +G R PG PEA TLARWICQ Sbjct: 647 YESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGPRPPPGTPEALTLARWICQ 706 Query: 17 SYRIH 3 SYR+H Sbjct: 707 SYRLH 711 >gb|ABB94031.1| homeodomain-leucine zipper trancription factor HB-3 [Picea glauca] Length = 842 Score = 155 bits (391), Expect(2) = 3e-56 Identities = 74/98 (75%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEA+LS+DMFLLQLCSG+DENA G+C++L+FAPID +F+ Sbjct: 522 HTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVFAPIDESFA 581 Query: 330 DDAPLLPSGFRIIPMESGQD-AASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ES D + PNRTLDLAS+LE+G Sbjct: 582 DDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVG 619 Score = 89.4 bits (220), Expect(2) = 3e-56 Identities = 44/65 (67%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VAAMA QYVR V+ASVQRVAMAL+P S+ +G R PG PEA TLARWICQ Sbjct: 647 YESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGPRPPPGTPEALTLARWICQ 706 Query: 17 SYRIH 3 SYR+H Sbjct: 707 SYRLH 711 >gb|ABB93496.1| homeodomain-leucine zipper trancription factor HB-3 [Picea abies] Length = 842 Score = 155 bits (391), Expect(2) = 3e-56 Identities = 74/98 (75%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEA+LS+DMFLLQLCSG+DENA G+C++L+FAPID +F+ Sbjct: 522 HTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVFAPIDESFA 581 Query: 330 DDAPLLPSGFRIIPMESGQD-AASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ES D + PNRTLDLAS+LE+G Sbjct: 582 DDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVG 619 Score = 89.4 bits (220), Expect(2) = 3e-56 Identities = 44/65 (67%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VAAMA QYVR V+ASVQRVAMAL+P S+ +G R PG PEA TLARWICQ Sbjct: 647 YESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGPRPPPGTPEALTLARWICQ 706 Query: 17 SYRIH 3 SYR+H Sbjct: 707 SYRLH 711 >gb|ABG73247.1| class III HD-Zip protein HDZ33 [Pinus taeda] Length = 840 Score = 167 bits (422), Expect(2) = 3e-56 Identities = 80/97 (82%), Positives = 91/97 (93%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT+EEALLSKDMFLLQLCSG+DE+A G CSQL+FAPIDA+F+ Sbjct: 520 HTVEHEEFLEVIKLEGHGLTHEEALLSKDMFLLQLCSGIDEHAAGFCSQLVFAPIDASFA 579 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ESG D + PNRTLDLAS+LEIG Sbjct: 580 DDAPLLPSGFRVIPLESGSDVSPPNRTLDLASALEIG 616 Score = 77.4 bits (189), Expect(2) = 3e-56 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSP-QHSSQLGMRSLPGAPEAGTLARWICQ 18 YQ ++++ VAAM QYVR VIASVQRVA+AL+P Q S +G R PG PEA TL RWI Q Sbjct: 645 YQNNVRDSVAAMTRQYVRNVIASVQRVAIALAPSQQSPHIGPRLPPGTPEALTLTRWIFQ 704 Query: 17 SYRIH 3 SYR+H Sbjct: 705 SYRMH 709 >gb|ADE76969.1| unknown [Picea sitchensis] Length = 353 Score = 155 bits (391), Expect(2) = 3e-56 Identities = 74/98 (75%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEA+LS+DMFLLQLCSG+DENA G+C++L+FAPID +F+ Sbjct: 61 HTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAELVFAPIDESFA 120 Query: 330 DDAPLLPSGFRIIPMESGQD-AASPNRTLDLASSLEIG 220 DDAPLLPSGFR+IP+ES D + PNRTLDLAS+LE+G Sbjct: 121 DDAPLLPSGFRVIPLESRTDGSGGPNRTLDLASALEVG 158 Score = 89.4 bits (220), Expect(2) = 3e-56 Identities = 44/65 (67%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VAAMA QYVR V+ASVQRVAMAL+P S+ +G R PG PEA TLARWICQ Sbjct: 186 YESHLRENVAAMARQYVRSVVASVQRVAMALAPSRLSAHVGPRPPPGTPEALTLARWICQ 245 Query: 17 SYRIH 3 SYR+H Sbjct: 246 SYRLH 250 >gb|ADV04324.1| class III homeodomain leucine zipper protein [Picea glauca] Length = 845 Score = 159 bits (402), Expect(2) = 6e-56 Identities = 74/97 (76%), Positives = 90/97 (92%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE +GLT EEALLS+DMFLLQLCSG+DENA G+C++L+FAPIDA+ + Sbjct: 525 HTVEHEEFLEVIKLENNGLTQEEALLSRDMFLLQLCSGIDENAVGACAELVFAPIDASLA 584 Query: 330 DDAPLLPSGFRIIPMESGQDAASPNRTLDLASSLEIG 220 D +PLLPSGFR+IP++SG D +SPNRTLDLAS+LEIG Sbjct: 585 DSSPLLPSGFRVIPLDSGMDGSSPNRTLDLASALEIG 621 Score = 84.3 bits (207), Expect(2) = 6e-56 Identities = 42/65 (64%), Positives = 50/65 (76%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 ++ H++E+VA MA QYVR V+ASVQRVAMAL+P S LG R PG PEA TLARW+CQ Sbjct: 650 FENHLRENVATMARQYVRGVVASVQRVAMALAPSRLGSHLGPRLPPGTPEALTLARWVCQ 709 Query: 17 SYRIH 3 SYR H Sbjct: 710 SYRFH 714 >gb|ABD75306.1| class III homeodomain-leucine zipper protein C3HDZ1 [Ginkgo biloba] Length = 842 Score = 156 bits (394), Expect(2) = 6e-56 Identities = 75/98 (76%), Positives = 89/98 (90%), Gaps = 1/98 (1%) Frame = -1 Query: 510 HTVENEEFLEVIKLERHGLTNEEALLSKDMFLLQLCSGVDENATGSCSQLLFAPIDATFS 331 HTVE+EEFLEVIKLE HGLT EEA+LS+DMFLLQLCSG+DENA G+C+QL+FAPID +F+ Sbjct: 521 HTVEHEEFLEVIKLEGHGLTQEEAVLSRDMFLLQLCSGIDENAAGACAQLVFAPIDESFA 580 Query: 330 DDAPLLPSGFRIIPMESGQDAAS-PNRTLDLASSLEIG 220 DDAPLLPSGFR+IP++S D S PNRTLDLAS+LE+G Sbjct: 581 DDAPLLPSGFRVIPLDSRTDGTSGPNRTLDLASALEVG 618 Score = 87.4 bits (215), Expect(2) = 6e-56 Identities = 44/65 (67%), Positives = 52/65 (80%), Gaps = 1/65 (1%) Frame = -2 Query: 194 YQCHMQEHVAAMASQYVRRVIASVQRVAMALSPQH-SSQLGMRSLPGAPEAGTLARWICQ 18 Y+ H++E+VA+MA QYVR V+ASVQRVAMAL+P SS +G R PG PEA TLARWICQ Sbjct: 647 YENHLRENVASMARQYVRSVVASVQRVAMALAPSRLSSHVGPRLPPGTPEALTLARWICQ 706 Query: 17 SYRIH 3 SYR H Sbjct: 707 SYRFH 711