BLASTX nr result
ID: Ephedra25_contig00009549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00009549 (803 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQ82685.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 63 1e-07 gb|ACN40476.1| unknown [Picea sitchensis] 63 1e-07 gb|ADE76565.1| unknown [Picea sitchensis] 62 2e-07 ref|XP_006390188.1| hypothetical protein EUTSA_v10018320mg [Eutr... 61 4e-07 sp|P14891.1|HMDH1_ARATH RecName: Full=3-hydroxy-3-methylglutaryl... 61 4e-07 ref|XP_002887642.1| 3-hydroxy-3-methylglutaryl CoA reductase [Ar... 61 4e-07 dbj|BAH57213.1| AT1G76490 [Arabidopsis thaliana] 61 4e-07 ref|NP_177775.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase... 61 4e-07 emb|CAA48611.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Rap... 61 4e-07 gb|EXB40446.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2... 61 5e-07 gb|EOX98939.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1... 61 5e-07 gb|AFG59021.1| hypothetical protein CL770Contig1_07, partial [Pi... 60 7e-07 gb|AET72043.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2... 60 7e-07 gb|AEL30660.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Paris f... 60 7e-07 gb|AEH16571.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 60 7e-07 gb|AAU89123.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 60 7e-07 gb|AHA85705.1| HMGR, partial [Houttuynia cordata] 60 9e-07 gb|AGW82424.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [... 60 9e-07 ref|XP_006302046.1| hypothetical protein CARUB_v10020027mg [Caps... 60 9e-07 gb|ADX01170.1| putative 3-hydroxy-3-methyl-glutaryl-CoA reductas... 60 9e-07 >gb|AAQ82685.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Taxus x media] Length = 595 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKAS 702 VLAGELSLMSALAAGQLV+SHMKYNRSSKD+KA+ Sbjct: 554 VLAGELSLMSALAAGQLVKSHMKYNRSSKDIKAA 587 >gb|ACN40476.1| unknown [Picea sitchensis] Length = 580 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKA 705 VLAGELSLMSALAAGQLV+SHMKYNRSSKD+KA Sbjct: 546 VLAGELSLMSALAAGQLVKSHMKYNRSSKDIKA 578 >gb|ADE76565.1| unknown [Picea sitchensis] Length = 305 Score = 62.4 bits (150), Expect = 2e-07 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKASN 699 VLAGELSLMSALAAGQLV+SHMKYNRS+KD+KA++ Sbjct: 271 VLAGELSLMSALAAGQLVKSHMKYNRSNKDMKANS 305 >ref|XP_006390188.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum] gi|557086622|gb|ESQ27474.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum] Length = 594 Score = 61.2 bits (147), Expect = 4e-07 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKASNTS 693 VLAGELSLMSA+AAGQLVRSHMKYNRSS+D+ + T+ Sbjct: 555 VLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGATTA 591 >sp|P14891.1|HMDH1_ARATH RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; Short=AtHMGR1; Short=HMG-CoA reductase 1 gi|6554470|gb|AAF16652.1|AC012394_1 hydroxy methylglutaryl CoA reductase (AA 1-592); 9510-7255 [Arabidopsis thaliana] gi|12323986|gb|AAG51957.1|AC015450_18 3-hydroxy-3-methylglutaryl CoA reductase (AA 1-592); 32253-34508 [Arabidopsis thaliana] gi|14326475|gb|AAK60283.1|AF385690_1 At1g76490/F15M4.1 [Arabidopsis thaliana] gi|16336|emb|CAA33139.1| unnamed protein product [Arabidopsis thaliana] gi|166750|gb|AAA76821.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis thaliana] gi|388556|gb|AAA32814.1| hydroxymethylglutaryl CoA reductase [Arabidopsis thaliana] gi|23397126|gb|AAN31847.1| putative 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis thaliana] gi|34365559|gb|AAQ65091.1| At1g76490/F15M4.1 [Arabidopsis thaliana] Length = 592 Score = 61.2 bits (147), Expect = 4e-07 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKASNTS 693 VLAGELSLMSA+AAGQLVRSHMKYNRSS+D+ + T+ Sbjct: 551 VLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGATTT 587 >ref|XP_002887642.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata subsp. lyrata] gi|297333483|gb|EFH63901.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata subsp. lyrata] Length = 635 Score = 61.2 bits (147), Expect = 4e-07 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKASNTS 693 VLAGELSLMSA+AAGQLVRSHMKYNRSS+D+ + T+ Sbjct: 596 VLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGATTT 632 >dbj|BAH57213.1| AT1G76490 [Arabidopsis thaliana] Length = 91 Score = 61.2 bits (147), Expect = 4e-07 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKASNTS 693 VLAGELSLMSA+AAGQLVRSHMKYNRSS+D+ + T+ Sbjct: 50 VLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGATTT 86 >ref|NP_177775.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Arabidopsis thaliana] gi|40218407|gb|AAR83122.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase isoform 1L [Arabidopsis thaliana] gi|332197728|gb|AEE35849.1| hydroxy methylglutaryl CoA reductase 1 [Arabidopsis thaliana] Length = 642 Score = 61.2 bits (147), Expect = 4e-07 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKASNTS 693 VLAGELSLMSA+AAGQLVRSHMKYNRSS+D+ + T+ Sbjct: 601 VLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGATTT 637 >emb|CAA48611.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Raphanus sativus] Length = 573 Score = 61.2 bits (147), Expect = 4e-07 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKASNTS 693 VLAGELSLMSA+AAGQLVRSHMKYNRSS+D+ + T+ Sbjct: 536 VLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGATTT 572 >gb|EXB40446.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Morus notabilis] Length = 586 Score = 60.8 bits (146), Expect = 5e-07 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKASNTS 693 VLAGELSLMSALAAGQLV+SHMKYNRSSKD+ A +S Sbjct: 550 VLAGELSLMSALAAGQLVKSHMKYNRSSKDVSAVASS 586 >gb|EOX98939.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma cacao] gi|508707044|gb|EOX98940.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma cacao] gi|508707045|gb|EOX98941.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma cacao] Length = 584 Score = 60.8 bits (146), Expect = 5e-07 Identities = 33/36 (91%), Positives = 35/36 (97%), Gaps = 1/36 (2%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDL-KASN 699 VLAGELSLMSALAAGQLVRSHMKYNRSSKD+ KAS+ Sbjct: 549 VLAGELSLMSALAAGQLVRSHMKYNRSSKDVSKASS 584 >gb|AFG59021.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153787|gb|AFG59022.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153789|gb|AFG59023.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153791|gb|AFG59024.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153793|gb|AFG59025.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153795|gb|AFG59026.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153797|gb|AFG59027.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153799|gb|AFG59028.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153801|gb|AFG59029.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153803|gb|AFG59030.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153805|gb|AFG59031.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153807|gb|AFG59032.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] gi|383153809|gb|AFG59033.1| hypothetical protein CL770Contig1_07, partial [Pinus taeda] Length = 38 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKA 705 VLAGELSLMSALAAGQLV+SHMKYNRS KD+KA Sbjct: 4 VLAGELSLMSALAAGQLVKSHMKYNRSIKDIKA 36 >gb|AET72043.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Litchi chinensis] Length = 568 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDL 711 VLAGELSLMSALAAGQLVRSHMKYNRSSKD+ Sbjct: 533 VLAGELSLMSALAAGQLVRSHMKYNRSSKDM 563 >gb|AEL30660.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Paris fargesii] gi|440573230|gb|AGC13078.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Paris fargesii] Length = 575 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKAS 702 VLAGELSLMSALAAGQLV+SHMKYNRSSKD+ S Sbjct: 536 VLAGELSLMSALAAGQLVKSHMKYNRSSKDMSKS 569 >gb|AEH16571.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Paris fargesii] Length = 232 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKAS 702 VLAGELSLMSALAAGQLV+SHMKYNRSSKD+ S Sbjct: 193 VLAGELSLMSALAAGQLVKSHMKYNRSSKDMSKS 226 >gb|AAU89123.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Ginkgo biloba] Length = 571 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKAS 702 VLAGELSLMSALAAGQLV SHMKYNRSSKD+K + Sbjct: 537 VLAGELSLMSALAAGQLVNSHMKYNRSSKDVKTT 570 >gb|AHA85705.1| HMGR, partial [Houttuynia cordata] Length = 228 Score = 60.1 bits (144), Expect = 9e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDL 711 VLAGELSLMSALAAGQLVRSHMKYNRSSKD+ Sbjct: 193 VLAGELSLMSALAAGQLVRSHMKYNRSSKDV 223 >gb|AGW82424.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Corylus avellana] Length = 565 Score = 60.1 bits (144), Expect = 9e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDL 711 VLAGELSLMSALAAGQLVRSHMKYNRSSKD+ Sbjct: 530 VLAGELSLMSALAAGQLVRSHMKYNRSSKDV 560 >ref|XP_006302046.1| hypothetical protein CARUB_v10020027mg [Capsella rubella] gi|482570756|gb|EOA34944.1| hypothetical protein CARUB_v10020027mg [Capsella rubella] Length = 592 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDLKASNTS 693 VLAGELSLMSA+AAGQLVRSHMKYNRSS+D+ T+ Sbjct: 551 VLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGGATT 587 >gb|ADX01170.1| putative 3-hydroxy-3-methyl-glutaryl-CoA reductase [Bacopa monnieri] Length = 563 Score = 60.1 bits (144), Expect = 9e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 803 VLAGELSLMSALAAGQLVRSHMKYNRSSKDL 711 VLAGELSLMSALAAGQLVRSHMKYNRSSKD+ Sbjct: 527 VLAGELSLMSALAAGQLVRSHMKYNRSSKDV 557