BLASTX nr result
ID: Ephedra25_contig00009017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00009017 (584 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005310521.1| protein RnhA [Paenibacillus mucilaginosus 30... 58 2e-06 ref|YP_004638949.1| protein RnhA [Paenibacillus mucilaginosus KN... 58 2e-06 ref|WP_022794665.1| ribonuclease H [Marinococcus halotolerans] 57 3e-06 gb|EWC92701.1| caulimovirus viroplasmin [Porphyromonas catoniae ... 57 3e-06 ref|WP_005467675.1| putative ribonuclease H [Porphyromonas caton... 57 3e-06 ref|WP_009432255.1| ribonuclease H [Porphyromonas sp. oral taxon... 57 5e-06 ref|WP_021667318.1| putative ribonuclease H [Porphyromonas sp. o... 56 8e-06 >ref|YP_005310521.1| protein RnhA [Paenibacillus mucilaginosus 3016] gi|386720956|ref|YP_006187281.1| ribonuclease H [Paenibacillus mucilaginosus K02] gi|504176351|ref|WP_014368275.1| ribonuclease H [Paenibacillus mucilaginosus] gi|378567062|gb|AFC27372.1| RnhA [Paenibacillus mucilaginosus 3016] gi|384088080|gb|AFH59516.1| ribonuclease H [Paenibacillus mucilaginosus K02] Length = 226 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = +1 Query: 451 WYVVFVGRQPGVYNTWAECDEQRCGFSKPKFRKFDSLEEA 570 WYVV+ GRQPGVY TWAEC Q GF + KF+ ++S EA Sbjct: 6 WYVVWEGRQPGVYKTWAECQAQTSGFPQAKFKAYESEAEA 45 >ref|YP_004638949.1| protein RnhA [Paenibacillus mucilaginosus KNP414] gi|503680169|ref|WP_013914245.1| ribonuclease H [Paenibacillus mucilaginosus] gi|336295976|gb|AEI39079.1| RnhA [Paenibacillus mucilaginosus KNP414] Length = 226 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = +1 Query: 451 WYVVFVGRQPGVYNTWAECDEQRCGFSKPKFRKFDSLEEA 570 WYVV+ GRQPGVY TWAEC Q GF + KF+ ++S EA Sbjct: 6 WYVVWEGRQPGVYKTWAECQAQTSGFPQAKFKAYESEAEA 45 >ref|WP_022794665.1| ribonuclease H [Marinococcus halotolerans] Length = 214 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/47 (48%), Positives = 33/47 (70%) Frame = +1 Query: 430 RHSMVRYWYVVFVGRQPGVYNTWAECDEQRCGFSKPKFRKFDSLEEA 570 R + WYVV+ G++PG+Y+TWAEC++Q GF +F+ F S EEA Sbjct: 17 RQMAKKKWYVVWKGKKPGIYSTWAECEKQVKGFKGARFKSFSSYEEA 63 >gb|EWC92701.1| caulimovirus viroplasmin [Porphyromonas catoniae ATCC 51270] Length = 208 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/44 (52%), Positives = 28/44 (63%) Frame = +1 Query: 451 WYVVFVGRQPGVYNTWAECDEQRCGFSKPKFRKFDSLEEAVFRY 582 WYVV+ G +PGVY TW+EC Q G+ KF+ FDS EA Y Sbjct: 7 WYVVWAGHEPGVYETWSECQAQTTGYPNAKFKAFDSEREARMAY 50 >ref|WP_005467675.1| putative ribonuclease H [Porphyromonas catoniae] gi|429157648|gb|EKY00229.1| putative ribonuclease H [Porphyromonas catoniae F0037] Length = 208 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/44 (52%), Positives = 28/44 (63%) Frame = +1 Query: 451 WYVVFVGRQPGVYNTWAECDEQRCGFSKPKFRKFDSLEEAVFRY 582 WYVV+ G +PGVY TW+EC Q G+ KF+ FDS EA Y Sbjct: 7 WYVVWAGHEPGVYETWSECQAQTTGYPNAKFKAFDSEREARMAY 50 >ref|WP_009432255.1| ribonuclease H [Porphyromonas sp. oral taxon 279] gi|402268566|gb|EJU17933.1| caulimovirus viroplasmin [Porphyromonas sp. oral taxon 279 str. F0450] Length = 251 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/44 (52%), Positives = 29/44 (65%) Frame = +1 Query: 451 WYVVFVGRQPGVYNTWAECDEQRCGFSKPKFRKFDSLEEAVFRY 582 WYVV+ G +PGVY TWAEC Q G+ K F+ F+S EA+ Y Sbjct: 49 WYVVWAGHEPGVYETWAECQRQTQGYPKALFKSFESRSEALRAY 92 >ref|WP_021667318.1| putative ribonuclease H [Porphyromonas sp. oral taxon 278] gi|543965280|gb|ERJ71989.1| putative ribonuclease H [Porphyromonas sp. oral taxon 278 str. W7784] Length = 209 Score = 55.8 bits (133), Expect = 8e-06 Identities = 22/46 (47%), Positives = 29/46 (63%) Frame = +1 Query: 445 RYWYVVFVGRQPGVYNTWAECDEQRCGFSKPKFRKFDSLEEAVFRY 582 R WYVV+ G +PGVY TW EC Q G+ P F+ F+S +A+ Y Sbjct: 5 RKWYVVWAGHEPGVYETWVECQRQTQGYPSPVFKSFESHSDALRAY 50