BLASTX nr result
ID: Ephedra25_contig00007911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00007911 (513 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006402619.1| hypothetical protein EUTSA_v10005858mg [Eutr... 55 1e-05 >ref|XP_006402619.1| hypothetical protein EUTSA_v10005858mg [Eutrema salsugineum] gi|557103718|gb|ESQ44072.1| hypothetical protein EUTSA_v10005858mg [Eutrema salsugineum] Length = 583 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/54 (55%), Positives = 33/54 (61%) Frame = -2 Query: 512 YTLRFGLHYVDFNNGTLDRYPKASVKWFKNFLGPSFPSQRWSSH*NYTLEK*CA 351 YT RFGL+YVDF NG L RYPK SVKWFK FL S R + +K CA Sbjct: 472 YTARFGLYYVDFING-LKRYPKDSVKWFKRFLKRSIGETREKDAKEMSRDKSCA 524