BLASTX nr result
ID: Ephedra25_contig00007724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00007724 (1065 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ23650.1| hypothetical protein PRUPE_ppa006185mg [Prunus pe... 70 2e-09 ref|XP_004291350.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-... 69 4e-09 ref|XP_003555834.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-... 68 5e-09 ref|XP_003536743.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-... 68 5e-09 gb|ESW14746.1| hypothetical protein PHAVU_007G014100g [Phaseolus... 67 2e-08 ref|XP_002510553.1| zinc finger protein, putative [Ricinus commu... 67 2e-08 ref|XP_004497245.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-... 66 2e-08 gb|EPS63574.1| hypothetical protein M569_11208, partial [Genlise... 65 5e-08 ref|XP_006359434.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-... 64 1e-07 ref|XP_004247465.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-... 63 2e-07 >gb|EMJ23650.1| hypothetical protein PRUPE_ppa006185mg [Prunus persica] Length = 423 Score = 69.7 bits (169), Expect = 2e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -2 Query: 125 RVLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDAG 3 R+LDW EIL GLEDN+IE RL +PE D YIGNPEDYVD AG Sbjct: 274 RILDWAEILMGLEDNSIEFRLEVPESDRYIGNPEDYVDAAG 314 >ref|XP_004291350.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Fragaria vesca subsp. vesca] Length = 358 Score = 68.6 bits (166), Expect = 4e-09 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -2 Query: 131 SGR--VLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDAG 3 SGR +LDW EIL GLEDN+IELR +PE D Y+GNPEDYVD AG Sbjct: 198 SGRNQILDWAEILMGLEDNSIELRFEMPESDRYVGNPEDYVDAAG 242 >ref|XP_003555834.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Glycine max] Length = 337 Score = 68.2 bits (165), Expect = 5e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 125 RVLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDA 6 R+LDW EIL GLEDN+IE RL LPE D Y+GNPEDYVD A Sbjct: 175 RILDWAEILMGLEDNSIEFRLQLPESDRYVGNPEDYVDAA 214 >ref|XP_003536743.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like isoform 1 [Glycine max] Length = 333 Score = 68.2 bits (165), Expect = 5e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 125 RVLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDA 6 R+LDW EIL GLEDN+IE RL LPE D Y+GNPEDYVD A Sbjct: 178 RILDWAEILMGLEDNSIEFRLQLPESDRYVGNPEDYVDAA 217 >gb|ESW14746.1| hypothetical protein PHAVU_007G014100g [Phaseolus vulgaris] Length = 342 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 125 RVLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDA 6 R+LDW EIL GLEDN+IE RL +PE D Y+GNPEDYVD A Sbjct: 180 RILDWAEILMGLEDNSIEFRLRVPESDRYVGNPEDYVDAA 219 >ref|XP_002510553.1| zinc finger protein, putative [Ricinus communis] gi|223551254|gb|EEF52740.1| zinc finger protein, putative [Ricinus communis] Length = 358 Score = 66.6 bits (161), Expect = 2e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 125 RVLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDAG 3 R+LDW EIL GLEDN+IE L +PE D YIGNPEDYVD AG Sbjct: 194 RILDWAEILMGLEDNSIEFLLEVPETDRYIGNPEDYVDAAG 234 >ref|XP_004497245.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Cicer arietinum] Length = 340 Score = 66.2 bits (160), Expect = 2e-08 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 125 RVLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDA 6 R+LDW EIL GLEDN+IE RL PE D Y+GNPEDYVD A Sbjct: 180 RILDWAEILMGLEDNSIEFRLQAPESDRYVGNPEDYVDAA 219 >gb|EPS63574.1| hypothetical protein M569_11208, partial [Genlisea aurea] Length = 243 Score = 65.1 bits (157), Expect = 5e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 125 RVLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDAG 3 R+LDW EIL GLED ++ELRL +P+ D YIGNP DYVD AG Sbjct: 101 RILDWAEILMGLEDQSVELRLQVPDSDAYIGNPGDYVDAAG 141 >ref|XP_006359434.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Solanum tuberosum] Length = 378 Score = 63.9 bits (154), Expect = 1e-07 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = -2 Query: 170 DWNAQAGGARLESSGRVLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDAG 3 D+ A+A R R+LDW EIL GLED++IELR +P+ D YIGNP DYVD AG Sbjct: 193 DFAARAANRR----NRILDWAEILMGLEDHSIELRFQVPDGDGYIGNPGDYVDAAG 244 >ref|XP_004247465.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Solanum lycopersicum] Length = 377 Score = 63.2 bits (152), Expect = 2e-07 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = -2 Query: 170 DWNAQAGGARLESSGRVLDWNEILRGLEDNTIELRLSLPEEDTYIGNPEDYVDDAG 3 D+ A+A R R+LDW EIL GLED++IELRL +P+ D Y+GNP DYVD G Sbjct: 194 DFAARAANRR----NRILDWAEILMGLEDHSIELRLQVPDGDGYVGNPGDYVDAEG 245