BLASTX nr result
ID: Ephedra25_contig00007630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00007630 (465 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006293973.1| hypothetical protein CARUB_v10022963mg, part... 57 3e-06 ref|XP_006411050.1| hypothetical protein EUTSA_v10016492mg [Eutr... 56 6e-06 >ref|XP_006293973.1| hypothetical protein CARUB_v10022963mg, partial [Capsella rubella] gi|482562681|gb|EOA26871.1| hypothetical protein CARUB_v10022963mg, partial [Capsella rubella] Length = 536 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/75 (32%), Positives = 47/75 (62%) Frame = +3 Query: 12 ISITKEEYALFQRKTEEAKEQADKRISELLAEVQDIRSEKSEIVERIDSMKLELETSKKR 191 ++I+ EEYA+ R +A+E+ KR+ + ++ V++ KS++++++D E+ETSK+ Sbjct: 304 VTISSEEYAVLARSARDAEEEGRKRVEDAMSRVEEANVSKSDVLKKVDEAAQEIETSKRA 363 Query: 192 AEAVSEELVAAQKAK 236 E E + AA +K Sbjct: 364 LEEAVERVDAANTSK 378 >ref|XP_006411050.1| hypothetical protein EUTSA_v10016492mg [Eutrema salsugineum] gi|557112219|gb|ESQ52503.1| hypothetical protein EUTSA_v10016492mg [Eutrema salsugineum] Length = 536 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/75 (33%), Positives = 45/75 (60%) Frame = +3 Query: 12 ISITKEEYALFQRKTEEAKEQADKRISELLAEVQDIRSEKSEIVERIDSMKLELETSKKR 191 ++I+ EEYA+ R +A+E A KR+ + ++ V++ K ++++++D E+ETSKK Sbjct: 301 VTISAEEYAVLARNARDAEEVARKRVEDAMSRVEEANVSKMDVLKKVDEASQEIETSKKA 360 Query: 192 AEAVSEELVAAQKAK 236 E E + AA K Sbjct: 361 LEEAVERVDAANATK 375