BLASTX nr result
ID: Ephedra25_contig00004859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00004859 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291731.1| PREDICTED: rhodanese-like/PpiC domain-contai... 55 1e-05 >ref|XP_004291731.1| PREDICTED: rhodanese-like/PpiC domain-containing protein 12-like [Fragaria vesca subsp. vesca] Length = 285 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +3 Query: 3 DTYVLCHVGKEAPKVAEMLKARGFKRVYYILGGIHEYAR 119 DTYV+CH G + +VA+ L+ +GFKRV+ + GGIHEYAR Sbjct: 238 DTYVMCHHGMRSLQVAQWLQTQGFKRVFNVAGGIHEYAR 276