BLASTX nr result
ID: Ephedra25_contig00004577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00004577 (704 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW08392.1| hypothetical protein 2_8144_01, partial [Pinus ra... 57 6e-06 >gb|AEW08392.1| hypothetical protein 2_8144_01, partial [Pinus radiata] gi|383146991|gb|AFG55243.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383146993|gb|AFG55244.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383146995|gb|AFG55245.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383146997|gb|AFG55246.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383146999|gb|AFG55247.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383147001|gb|AFG55248.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383147003|gb|AFG55249.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383147005|gb|AFG55250.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383147007|gb|AFG55251.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383147009|gb|AFG55252.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383147011|gb|AFG55253.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383147013|gb|AFG55254.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383147015|gb|AFG55255.1| hypothetical protein 2_8144_01, partial [Pinus taeda] gi|383147017|gb|AFG55256.1| hypothetical protein 2_8144_01, partial [Pinus taeda] Length = 112 Score = 57.0 bits (136), Expect = 6e-06 Identities = 38/104 (36%), Positives = 51/104 (49%), Gaps = 2/104 (1%) Frame = +2 Query: 5 PWRKYKYMHNKWLGSYTRSTTATQFSPQSSPPQLHRNENCEVPVQRSSDEEFKSQALDSM 184 PWRKY+YM KWLGSY R+T S S PP SS + A+ + Sbjct: 10 PWRKYRYMKPKWLGSYRRTTNPVPASNSSLPP--------------SSRTFNPAGAMGNK 55 Query: 185 ALNFTYAECL--EWIPPKVVAPKAKLTHCHNGKILGGLASAFIQ 310 L+ ++ + EW PP V P++K + G + GLASA IQ Sbjct: 56 CLDISFHHLVLGEWKPPS-VNPESKNPAMNGGGKVSGLASALIQ 98