BLASTX nr result
ID: Dioscorea21_contig00039408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039408 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002455173.1| hypothetical protein SORBIDRAFT_03g005520 [S... 55 5e-06 >ref|XP_002455173.1| hypothetical protein SORBIDRAFT_03g005520 [Sorghum bicolor] gi|241927148|gb|EES00293.1| hypothetical protein SORBIDRAFT_03g005520 [Sorghum bicolor] Length = 646 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/92 (34%), Positives = 54/92 (58%), Gaps = 8/92 (8%) Frame = +3 Query: 3 DPQVKELFNDVDKLRVEFGSIQRPTLEIEISKDKVSVSEGTSQSQKTSHLANTTYSPMSR 182 D +V+ LF+D+DKLR F S++RPTL+IE+ K K + E + S+ T + +++SP+ Sbjct: 519 DAEVRTLFSDIDKLREVFESVERPTLDIEVRKAKEPMKEKSGSSRSTKDKSESSHSPVQA 578 Query: 183 -------GIESSNS-AAFVIDLQSEKELERLE 254 ++S S A + L ++ EL +LE Sbjct: 579 PSSPKDVPVDSPKSPAKSELMLDTDSELAKLE 610