BLASTX nr result
ID: Dioscorea21_contig00039385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039385 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA60396.1| TPA: hypothetical protein ZEAMMB73_848744 [Zea m... 71 1e-10 tpg|DAA60395.1| TPA: folate/biopterin transporter family protein... 71 1e-10 ref|NP_001151276.1| folate/biopterin transporter family protein ... 71 1e-10 ref|XP_002461900.1| hypothetical protein SORBIDRAFT_02g010160 [S... 70 1e-10 dbj|BAJ86770.1| predicted protein [Hordeum vulgare subsp. vulgare] 70 2e-10 >tpg|DAA60396.1| TPA: hypothetical protein ZEAMMB73_848744 [Zea mays] Length = 454 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -2 Query: 287 GIFGVGIASIIGVSSGDYSSLPFGIVLQALASLLPLGWISHVP 159 G+FGVG++++IGVSS DYSSLP GI+LQ+LA+LLPLGWIS VP Sbjct: 399 GVFGVGLSTLIGVSSVDYSSLPLGILLQSLAALLPLGWISFVP 441 >tpg|DAA60395.1| TPA: folate/biopterin transporter family protein [Zea mays] Length = 520 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -2 Query: 287 GIFGVGIASIIGVSSGDYSSLPFGIVLQALASLLPLGWISHVP 159 G+FGVG++++IGVSS DYSSLP GI+LQ+LA+LLPLGWIS VP Sbjct: 465 GVFGVGLSTLIGVSSVDYSSLPLGILLQSLAALLPLGWISFVP 507 >ref|NP_001151276.1| folate/biopterin transporter family protein [Zea mays] gi|195645484|gb|ACG42210.1| folate/biopterin transporter family protein [Zea mays] Length = 520 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -2 Query: 287 GIFGVGIASIIGVSSGDYSSLPFGIVLQALASLLPLGWISHVP 159 G+FGVG++++IGVSS DYSSLP GI+LQ+LA+LLPLGWIS VP Sbjct: 465 GVFGVGLSTLIGVSSVDYSSLPLGILLQSLAALLPLGWISFVP 507 >ref|XP_002461900.1| hypothetical protein SORBIDRAFT_02g010160 [Sorghum bicolor] gi|241925277|gb|EER98421.1| hypothetical protein SORBIDRAFT_02g010160 [Sorghum bicolor] Length = 429 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -2 Query: 287 GIFGVGIASIIGVSSGDYSSLPFGIVLQALASLLPLGWISHVP 159 G+FGVG++++IGVSS DYSSLP GI+LQ+LA+LLPLGWIS VP Sbjct: 376 GVFGVGLSTLIGVSSVDYSSLPVGILLQSLAALLPLGWISFVP 418 >dbj|BAJ86770.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 504 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/50 (60%), Positives = 43/50 (86%) Frame = -2 Query: 287 GIFGVGIASIIGVSSGDYSSLPFGIVLQALASLLPLGWISHVPAVRNSEG 138 G++GVG++++IG+SSGDYSSLP GI+LQ+LA+LLPL W+S VP ++G Sbjct: 449 GVYGVGLSALIGLSSGDYSSLPLGILLQSLAALLPLAWLSFVPENWTADG 498