BLASTX nr result
ID: Dioscorea21_contig00039298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039298 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320170.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_002301386.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 emb|CAB80930.1| hypothetical protein [Arabidopsis thaliana] 55 4e-06 ref|XP_002511940.1| transferase, transferring glycosyl groups, p... 54 1e-05 >ref|XP_002320170.1| predicted protein [Populus trichocarpa] gi|222860943|gb|EEE98485.1| predicted protein [Populus trichocarpa] Length = 990 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 91 DCRMFVDALDAQIHDEHHQSGRCYLSLSKD 2 +C+MFVDALDAQ++DEHHQSGRCYLSL+KD Sbjct: 813 NCKMFVDALDAQMYDEHHQSGRCYLSLAKD 842 >ref|XP_002301386.1| predicted protein [Populus trichocarpa] gi|222843112|gb|EEE80659.1| predicted protein [Populus trichocarpa] Length = 990 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 91 DCRMFVDALDAQIHDEHHQSGRCYLSLSKD 2 +C+MFVDALDAQ++DEHHQSGRCYLS +KD Sbjct: 813 NCKMFVDALDAQMYDEHHQSGRCYLSPAKD 842 >emb|CAB80930.1| hypothetical protein [Arabidopsis thaliana] Length = 963 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = -3 Query: 91 DCRMFVDALDAQIHDEHHQSGRCYLSLSKD 2 +CRMFVD+LDAQI++EHH++ RCYLSL+KD Sbjct: 784 NCRMFVDSLDAQIYEEHHRTNRCYLSLTKD 813 >ref|XP_002511940.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223549120|gb|EEF50609.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 935 Score = 54.3 bits (129), Expect = 1e-05 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -3 Query: 91 DCRMFVDALDAQIHDEHHQSGRCYLSLSKD 2 +C++FVDALDAQI+D HHQ+G CYLSL+KD Sbjct: 758 NCKIFVDALDAQIYDLHHQNGHCYLSLTKD 787