BLASTX nr result
ID: Dioscorea21_contig00039271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039271 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC77634.1| 24K germin like protein [Nicotiana tabacum] 60 2e-07 gb|ADW66138.1| auxin-binding protein [Solanum nigrum] 59 5e-07 gb|ABV03161.1| germin-like protein [Chimonanthus praecox] 58 7e-07 gb|ABC86741.1| auxin-binding protein [Vitis pseudoreticulata] 57 2e-06 ref|XP_002516286.1| Auxin-binding protein ABP19a precursor, puta... 57 2e-06 >dbj|BAC77634.1| 24K germin like protein [Nicotiana tabacum] Length = 210 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +2 Query: 116 AADQDFCVGDINAPEGPAGYSCKKASLVTSNDFLSKDIFKPNQIFPTIELKLT 274 AA DFCVGD++ P+GP GY+CKK S VT+NDF+ + P ++ P I+ +T Sbjct: 18 AAVLDFCVGDLSVPDGPGGYACKKPSAVTANDFVFSGLATPVKLNPLIKAAVT 70 >gb|ADW66138.1| auxin-binding protein [Solanum nigrum] Length = 96 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +2 Query: 116 AADQDFCVGDINAPEGPAGYSCKKASLVTSNDFLSKDIFKPNQIFPTIELKLT 274 AA DFCVGD++ P+GP GYSCKK S VT++DF+ + P ++ P I+ +T Sbjct: 6 AAVLDFCVGDLSLPDGPCGYSCKKPSKVTADDFVFSGLATPVKLNPLIKAAVT 58 >gb|ABV03161.1| germin-like protein [Chimonanthus praecox] Length = 214 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = +2 Query: 116 AADQDFCVGDINAPEGPAGYSCKKASLVTSNDFLSKDIFKPNQIFPTIELKLT 274 AA QDFCVGD+ PEGPAGYSCKK ++VT +DF+ + K I +T Sbjct: 22 AAVQDFCVGDLTGPEGPAGYSCKKPAIVTVDDFVFSGLGKAGNTSNIIRAAVT 74 >gb|ABC86741.1| auxin-binding protein [Vitis pseudoreticulata] Length = 137 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 116 AADQDFCVGDINAPEGPAGYSCKKASLVTSNDFL 217 AA QDFCVGD+ APEGPAGYSCKK + VT +DF+ Sbjct: 17 AAVQDFCVGDLAAPEGPAGYSCKKPAKVTVDDFV 50 >ref|XP_002516286.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis] gi|223544772|gb|EEF46288.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis] Length = 208 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = +2 Query: 125 QDFCVGDINAPEGPAGYSCKKASLVTSNDFLSKDIFKPNQIFPTIELKLT 274 QD+CVGD++ P+GPAGY CKK VT NDF+ + P +I P I+ +T Sbjct: 21 QDYCVGDLSGPDGPAGYGCKKT--VTVNDFVYSGLAAPGKILPLIKAGVT 68