BLASTX nr result
ID: Dioscorea21_contig00039247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039247 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ37164.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkg... 64 1e-11 ref|YP_005352758.1| ndhA gene product (chloroplast) [Ginkgo bilo... 64 1e-11 ref|YP_001381679.1| NADH-plastoquinone oxidoreductase subunit 1 ... 70 2e-10 emb|CBI32733.3| unnamed protein product [Vitis vinifera] 52 6e-10 ref|YP_007375101.1| NADH-plastoquinone oxidoreductase subunit 1 ... 62 4e-08 >gb|AEQ37164.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkgo biloba] Length = 209 Score = 64.3 bits (155), Expect(2) = 1e-11 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 222 CYYRL*LSNSLSTVDIVEAQSKYGFWGWNLWRQ 320 C +RL L NSLSTVDI+EAQS+YGFWGWNLWRQ Sbjct: 22 CSHRLQLPNSLSTVDIIEAQSRYGFWGWNLWRQ 54 Score = 29.6 bits (65), Expect(2) = 1e-11 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 155 IEEPYEAEVSCTVLE*R*EQ 214 +EEPYEA+VS TVLE R EQ Sbjct: 1 MEEPYEAKVSRTVLEKRLEQ 20 >ref|YP_005352758.1| ndhA gene product (chloroplast) [Ginkgo biloba] gi|372862389|gb|AEX98471.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkgo biloba] gi|372862811|gb|AEX98888.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkgo biloba] gi|372862981|gb|AEX99056.1| NADH dehydrogenase subunit 1 (chloroplast) [Ginkgo biloba] Length = 209 Score = 64.3 bits (155), Expect(2) = 1e-11 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 222 CYYRL*LSNSLSTVDIVEAQSKYGFWGWNLWRQ 320 C +RL L NSLSTVDI+EAQS+YGFWGWNLWRQ Sbjct: 22 CSHRLQLPNSLSTVDIIEAQSRYGFWGWNLWRQ 54 Score = 29.6 bits (65), Expect(2) = 1e-11 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 155 IEEPYEAEVSCTVLE*R*EQ 214 +EEPYEA+VS TVLE R EQ Sbjct: 1 MEEPYEAKVSRTVLEKRLEQ 20 >ref|YP_001381679.1| NADH-plastoquinone oxidoreductase subunit 1 [Medicago truncatula] Length = 369 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 222 CYYRL*LSNSLSTVDIVEAQSKYGFWGWNLWRQ 320 CY+RL LSNSLSTVDIV+AQSKYGFWGWNLWRQ Sbjct: 185 CYHRLGLSNSLSTVDIVDAQSKYGFWGWNLWRQ 217 >emb|CBI32733.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 52.0 bits (123), Expect(2) = 6e-10 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = -3 Query: 310 RFHPQKPYFDCASTISTVLKLLDN 239 +FHPQKPYFDCASTISTVL+LLDN Sbjct: 106 KFHPQKPYFDCASTISTVLELLDN 129 Score = 36.6 bits (83), Expect(2) = 6e-10 Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 5/39 (12%) Frame = -2 Query: 209 PIAIPKPYMRPQLHTAPLWLQINVRTDSV-----NIFVG 108 PIAI +PYMR LHTAP IN+ T SV +IFVG Sbjct: 138 PIAITEPYMRFSLHTAPRGPIINLGTGSVLFIYLDIFVG 176 >ref|YP_007375101.1| NADH-plastoquinone oxidoreductase subunit 1 [Quercus rubra] gi|441421980|gb|AGC31304.1| NADH-plastoquinone oxidoreductase subunit 1 [Quercus rubra] Length = 363 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 240 LSNSLSTVDIVEAQSKYGFWGWNLWRQ 320 LSNSLSTVDIVEAQSKYGFWGWNLWRQ Sbjct: 185 LSNSLSTVDIVEAQSKYGFWGWNLWRQ 211