BLASTX nr result
ID: Dioscorea21_contig00039241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00039241 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002457610.1| hypothetical protein SORBIDRAFT_03g010260 [S... 59 5e-07 tpg|DAA54089.1| TPA: hypothetical protein ZEAMMB73_851506 [Zea m... 58 9e-07 >ref|XP_002457610.1| hypothetical protein SORBIDRAFT_03g010260 [Sorghum bicolor] gi|241929585|gb|EES02730.1| hypothetical protein SORBIDRAFT_03g010260 [Sorghum bicolor] Length = 1089 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/75 (42%), Positives = 45/75 (60%) Frame = +3 Query: 90 ISKSKNITADMVDMSNKFCKLGKENGRNKDHDHLIGKSLSHDFDSYYCIIASLCSKGELQ 269 + S I M+D + L + + D+ +L+GKS + DF+SYY IASLCSKGE+ Sbjct: 1018 LGSSDGIVQPMIDGDDILSNLSGDT--DIDYQNLLGKSPNDDFESYYAAIASLCSKGEVL 1075 Query: 270 KANSVVRAMLLSENC 314 KAN V AM+ +NC Sbjct: 1076 KANKAVEAMI--QNC 1088 >tpg|DAA54089.1| TPA: hypothetical protein ZEAMMB73_851506 [Zea mays] gi|414876959|tpg|DAA54090.1| TPA: hypothetical protein ZEAMMB73_851506 [Zea mays] Length = 1090 Score = 57.8 bits (138), Expect = 9e-07 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 150 LGKENGRNK-DHDHLIGKSLSHDFDSYYCIIASLCSKGELQKANSVVRAMLLSENC 314 L K +G D+ +L+GKS + DF+SYY IASLCSKGEL KAN V AM+ +NC Sbjct: 1036 LSKSSGDTDIDYRNLLGKSFNDDFESYYAGIASLCSKGELLKANKAVEAMI--QNC 1089