BLASTX nr result
ID: Dioscorea21_contig00037052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00037052 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516875.1| zinc finger protein, putative [Ricinus commu... 62 5e-08 ref|XP_002312758.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 gb|ADD54592.1| putative zinc finger protein [Linum usitatissimum] 61 8e-08 gb|AFK47591.1| unknown [Medicago truncatula] 60 1e-07 ref|XP_003593984.1| RING finger and CHY zinc finger domain-conta... 60 1e-07 >ref|XP_002516875.1| zinc finger protein, putative [Ricinus communis] gi|223543963|gb|EEF45489.1| zinc finger protein, putative [Ricinus communis] Length = 269 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +1 Query: 1 LCNDCNNTSEVVFHIIGRKCSRCGSYNTRKTVKPSLP 111 LCNDCN+T+EV FHIIG+KCS C SYNTR P LP Sbjct: 232 LCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAPPVLP 268 >ref|XP_002312758.1| predicted protein [Populus trichocarpa] gi|222852578|gb|EEE90125.1| predicted protein [Populus trichocarpa] Length = 269 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +1 Query: 1 LCNDCNNTSEVVFHIIGRKCSRCGSYNTRKTVKPSLP 111 LCNDCN+T+EV FHIIG+KCS C SYNTR P LP Sbjct: 232 LCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAPPVLP 268 >gb|ADD54592.1| putative zinc finger protein [Linum usitatissimum] Length = 109 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +1 Query: 1 LCNDCNNTSEVVFHIIGRKCSRCGSYNTRKTVKPSLP 111 LCNDCN+T+EV FHIIG+KCS C SYNTR P LP Sbjct: 71 LCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIQPPVLP 107 >gb|AFK47591.1| unknown [Medicago truncatula] Length = 267 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +1 Query: 1 LCNDCNNTSEVVFHIIGRKCSRCGSYNTRKTVKPSLP 111 LCNDCN+T+EV FHIIG KC C SYNTR P LP Sbjct: 230 LCNDCNDTTEVSFHIIGHKCGHCSSYNTRAIAPPVLP 266 >ref|XP_003593984.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] gi|355483032|gb|AES64235.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] Length = 267 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +1 Query: 1 LCNDCNNTSEVVFHIIGRKCSRCGSYNTRKTVKPSLP 111 LCNDCN+T+EV FHIIG KC C SYNTR P LP Sbjct: 230 LCNDCNDTTEVSFHIIGHKCGHCSSYNTRAIAPPVLP 266