BLASTX nr result
ID: Dioscorea21_contig00036854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00036854 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39785.3| unnamed protein product [Vitis vinifera] 88 6e-16 emb|CAN74282.1| hypothetical protein VITISV_016708 [Vitis vinifera] 88 6e-16 ref|XP_002267586.2| PREDICTED: E3 ubiquitin-protein ligase At4g1... 86 2e-15 ref|XP_002298883.1| predicted protein [Populus trichocarpa] gi|2... 81 1e-13 gb|ACU18237.1| unknown [Glycine max] 76 3e-12 >emb|CBI39785.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 88.2 bits (217), Expect = 6e-16 Identities = 42/66 (63%), Positives = 52/66 (78%), Gaps = 5/66 (7%) Frame = -3 Query: 253 MSHVGEDN-----NNGTARSPPAVFLVRTAVRISRARWFSFLRRVFWYQNGSRSDVMSNP 89 +S GED N ++R+PP+ FL+RTA+RISRARWFSFLRRVF YQNGSRSD+ +NP Sbjct: 24 LSPAGEDRMAAGVRNRSSRAPPSSFLIRTAMRISRARWFSFLRRVFHYQNGSRSDLGANP 83 Query: 88 FNSKSW 71 FNS +W Sbjct: 84 FNSSTW 89 >emb|CAN74282.1| hypothetical protein VITISV_016708 [Vitis vinifera] Length = 343 Score = 88.2 bits (217), Expect = 6e-16 Identities = 42/66 (63%), Positives = 52/66 (78%), Gaps = 5/66 (7%) Frame = -3 Query: 253 MSHVGEDN-----NNGTARSPPAVFLVRTAVRISRARWFSFLRRVFWYQNGSRSDVMSNP 89 +S GED N ++R+PP+ FL+RTA+RISRARWFSFLRRVF YQNGSRSD+ +NP Sbjct: 24 LSPAGEDRMAAGVRNRSSRAPPSSFLIRTAMRISRARWFSFLRRVFHYQNGSRSDLGANP 83 Query: 88 FNSKSW 71 FNS +W Sbjct: 84 FNSNTW 89 >ref|XP_002267586.2| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Vitis vinifera] Length = 312 Score = 86.3 bits (212), Expect = 2e-15 Identities = 38/52 (73%), Positives = 47/52 (90%) Frame = -3 Query: 226 NGTARSPPAVFLVRTAVRISRARWFSFLRRVFWYQNGSRSDVMSNPFNSKSW 71 N ++R+PP+ FL+RTA+RISRARWFSFLRRVF YQNGSRSD+ +NPFNS +W Sbjct: 7 NRSSRAPPSSFLIRTAMRISRARWFSFLRRVFHYQNGSRSDLGANPFNSSTW 58 >ref|XP_002298883.1| predicted protein [Populus trichocarpa] gi|222846141|gb|EEE83688.1| predicted protein [Populus trichocarpa] Length = 341 Score = 80.9 bits (198), Expect = 1e-13 Identities = 41/67 (61%), Positives = 50/67 (74%), Gaps = 5/67 (7%) Frame = -3 Query: 256 VMSHVGEDNN-----NGTARSPPAVFLVRTAVRISRARWFSFLRRVFWYQNGSRSDVMSN 92 V S GE++ N +AR+P + LVRTA+RISRARWF+FLRRVF YQNGSRS++ SN Sbjct: 18 VASPAGEEHGTVSLRNRSARTPTSSLLVRTAMRISRARWFTFLRRVFHYQNGSRSNLGSN 77 Query: 91 PFNSKSW 71 PFNS W Sbjct: 78 PFNSSPW 84 >gb|ACU18237.1| unknown [Glycine max] Length = 365 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = -3 Query: 226 NGTARSPPAVFLVRTAVRISRARWFSFLRRVFWYQNGSRSDVMSNPFNSKSW 71 N R P FLVR A+RISRARWF+FLRRVF YQNGSRS++ SNPFNS +W Sbjct: 34 NRPPRVTPPSFLVRIAMRISRARWFTFLRRVFHYQNGSRSNLGSNPFNSSTW 85