BLASTX nr result
ID: Dioscorea21_contig00036823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00036823 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297781.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_002513472.1| sorting and assembly machinery (sam50) prote... 55 5e-06 >ref|XP_002297781.1| predicted protein [Populus trichocarpa] gi|222845039|gb|EEE82586.1| predicted protein [Populus trichocarpa] Length = 512 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +1 Query: 1 GKIVNIRRLDEVINSINGWYIERGLFGLVGASQ 99 GK+VNI+ LDEVINSINGWY+ERGLFG+V ++ Sbjct: 48 GKVVNIKHLDEVINSINGWYMERGLFGMVSNAE 80 >ref|XP_002513472.1| sorting and assembly machinery (sam50) protein, putative [Ricinus communis] gi|223547380|gb|EEF48875.1| sorting and assembly machinery (sam50) protein, putative [Ricinus communis] Length = 700 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 GKIVNIRRLDEVINSINGWYIERGLFGLV 87 GK+VNIR LD+VI SINGWY+ERGLFGLV Sbjct: 236 GKVVNIRHLDDVITSINGWYMERGLFGLV 264