BLASTX nr result
ID: Dioscorea21_contig00036799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00036799 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus tr... 59 1e-15 >ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|134093265|ref|YP_001109566.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] gi|133712114|gb|ABO36757.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|133712127|gb|ABO36770.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] Length = 86 Score = 58.9 bits (141), Expect(2) = 1e-15 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -1 Query: 171 KDERKAYWLVIVRPQFLTGRDTKGLWPFISLE*IEKEGGHCKW 43 + ERKAYWLVIVRPQFLTG DTKGL P S+ I++EGG W Sbjct: 21 RHERKAYWLVIVRPQFLTGGDTKGLCP--SITWIDREGGRSFW 61 Score = 48.9 bits (115), Expect(2) = 1e-15 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -2 Query: 230 MDWCGSSTPRTPEYRIINEERMREK 156 MDWCGSSTPRTPEYR +NEER K Sbjct: 1 MDWCGSSTPRTPEYRTMNEERHERK 25