BLASTX nr result
ID: Dioscorea21_contig00036723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00036723 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW61677.1| hypothetical protein ZEAMMB73_487440 [Zea mays] 80 2e-13 ref|NP_001146001.1| uncharacterized protein LOC100279531 [Zea ma... 80 2e-13 gb|ACG46847.1| hypothetical protein [Zea mays] 80 2e-13 ref|XP_003606336.1| Auxin-regulated protein [Medicago truncatula... 77 2e-12 ref|XP_002523717.1| conserved hypothetical protein [Ricinus comm... 76 3e-12 >gb|AFW61677.1| hypothetical protein ZEAMMB73_487440 [Zea mays] Length = 584 Score = 79.7 bits (195), Expect = 2e-13 Identities = 37/60 (61%), Positives = 48/60 (80%) Frame = -3 Query: 318 KRSYKNGFVWHDLSEDDLVVPVRGNEYVLKGSEILDQSHGSDQGFNRVNFVKLECSQPVR 139 KRSYKNGFVWHDLS+DDLV+P +GNEY+LKGSE+LD+S D+ N V+ K+E +P + Sbjct: 119 KRSYKNGFVWHDLSDDDLVLPAQGNEYILKGSELLDRSPPLDRQQNGVSNPKVEGLKPCK 178 >ref|NP_001146001.1| uncharacterized protein LOC100279531 [Zea mays] gi|219885275|gb|ACL53012.1| unknown [Zea mays] gi|219885405|gb|ACL53077.1| unknown [Zea mays] Length = 602 Score = 79.7 bits (195), Expect = 2e-13 Identities = 37/60 (61%), Positives = 48/60 (80%) Frame = -3 Query: 318 KRSYKNGFVWHDLSEDDLVVPVRGNEYVLKGSEILDQSHGSDQGFNRVNFVKLECSQPVR 139 KRSYKNGFVWHDLS+DDLV+P +GNEY+LKGSE+LD+S D+ N V+ K+E +P + Sbjct: 119 KRSYKNGFVWHDLSDDDLVLPAQGNEYILKGSELLDRSPPLDRQQNGVSNPKVEGLKPCK 178 >gb|ACG46847.1| hypothetical protein [Zea mays] Length = 602 Score = 79.7 bits (195), Expect = 2e-13 Identities = 37/60 (61%), Positives = 48/60 (80%) Frame = -3 Query: 318 KRSYKNGFVWHDLSEDDLVVPVRGNEYVLKGSEILDQSHGSDQGFNRVNFVKLECSQPVR 139 KRSYKNGFVWHDLS+DDLV+P +GNEY+LKGSE+LD+S D+ N V+ K+E +P + Sbjct: 119 KRSYKNGFVWHDLSDDDLVLPAQGNEYILKGSELLDRSPPLDRQQNGVSNPKVEGLKPCK 178 >ref|XP_003606336.1| Auxin-regulated protein [Medicago truncatula] gi|355507391|gb|AES88533.1| Auxin-regulated protein [Medicago truncatula] Length = 530 Score = 76.6 bits (187), Expect = 2e-12 Identities = 37/55 (67%), Positives = 46/55 (83%) Frame = -3 Query: 321 SKRSYKNGFVWHDLSEDDLVVPVRGNEYVLKGSEILDQSHGSDQGFNRVNFVKLE 157 SKRSYKNGFVWHDL EDDL+ P GNEYVLKGSE+ D+S+ SD+ F+ +N VK++ Sbjct: 85 SKRSYKNGFVWHDLCEDDLIQPAHGNEYVLKGSELFDESN-SDR-FSPINDVKIQ 137 >ref|XP_002523717.1| conserved hypothetical protein [Ricinus communis] gi|223537021|gb|EEF38657.1| conserved hypothetical protein [Ricinus communis] Length = 525 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -3 Query: 318 KRSYKNGFVWHDLSEDDLVVPVRGNEYVLKGSEILDQSHGSDQGFNRVNFVKLE 157 KRSYKNGFVWHDLSEDDL++P GNEYVLKGSE+ D+S+ SD+ F V +K++ Sbjct: 89 KRSYKNGFVWHDLSEDDLILPAHGNEYVLKGSELFDESN-SDR-FGPVGTIKMQ 140