BLASTX nr result
ID: Dioscorea21_contig00036657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00036657 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521862.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002521862.1| conserved hypothetical protein [Ricinus communis] gi|223538900|gb|EEF40498.1| conserved hypothetical protein [Ricinus communis] Length = 382 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -3 Query: 287 SAHEKHYTANRXXXXXXXXXXXLPYRQGLFGCLRFNPAVNSIARGFSNQA 138 SAHE HYTANR LPY+QGL GCL FNP V+ I+RG + A Sbjct: 331 SAHELHYTANRAVSEEMKRKTFLPYKQGLLGCLGFNPGVHEISRGIGSLA 380