BLASTX nr result
ID: Dioscorea21_contig00036624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00036624 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538170.1| PREDICTED: ethylene-responsive transcription... 64 2e-08 ref|XP_003516719.1| PREDICTED: ethylene-responsive transcription... 64 2e-08 gb|ACJ37443.1| AP2 domain-containing transcription factor 9 [Gly... 64 2e-08 ref|XP_002270561.2| PREDICTED: ethylene-responsive transcription... 62 6e-08 ref|XP_003611004.1| Ethylene-responsive transcription factor ERF... 62 6e-08 >ref|XP_003538170.1| PREDICTED: ethylene-responsive transcription factor ERF061-like [Glycine max] Length = 325 Score = 63.5 bits (153), Expect = 2e-08 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = -2 Query: 336 TYDSAECAAIAYDRAAYKLRGEYAQLNFPN------LGAGVGEWAERLRLTVDEKIHA 181 TYD+AE AA AYDRAAYKLRGEYA+LNFPN LG G L+ +VD KI A Sbjct: 165 TYDTAEAAAYAYDRAAYKLRGEYARLNFPNLKDPTKLGFGDSARLNALKSSVDAKIQA 222 >ref|XP_003516719.1| PREDICTED: ethylene-responsive transcription factor ERF061-like [Glycine max] Length = 314 Score = 63.5 bits (153), Expect = 2e-08 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = -2 Query: 336 TYDSAECAAIAYDRAAYKLRGEYAQLNFPN------LGAGVGEWAERLRLTVDEKIHA 181 TYD+AE AA AYDRAAYKLRGEYA+LNFPN LG G L+ +VD KI A Sbjct: 145 TYDTAEAAAYAYDRAAYKLRGEYARLNFPNLKDPTKLGFGDSARLNALKSSVDAKIQA 202 >gb|ACJ37443.1| AP2 domain-containing transcription factor 9 [Glycine max] Length = 329 Score = 63.5 bits (153), Expect = 2e-08 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = -2 Query: 336 TYDSAECAAIAYDRAAYKLRGEYAQLNFPN------LGAGVGEWAERLRLTVDEKIHA 181 TYD+AE AA AYDRAAYKLRGEYA+LNFPN LG G L+ +VD KI A Sbjct: 165 TYDTAEAAAYAYDRAAYKLRGEYARLNFPNLKDPTKLGFGDSARLNALKSSVDAKIQA 222 >ref|XP_002270561.2| PREDICTED: ethylene-responsive transcription factor ERF061-like [Vitis vinifera] Length = 318 Score = 61.6 bits (148), Expect = 6e-08 Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 6/58 (10%) Frame = -2 Query: 336 TYDSAECAAIAYDRAAYKLRGEYAQLNFPNL----GAGVGEWA--ERLRLTVDEKIHA 181 T+D+AE AA AYDRAAYKLRGEYA+LNFPNL G G+ A L+ +VD KI A Sbjct: 132 TFDTAEAAAYAYDRAAYKLRGEYARLNFPNLRDASKLGFGDCARLNALKSSVDAKIQA 189 >ref|XP_003611004.1| Ethylene-responsive transcription factor ERF061 [Medicago truncatula] gi|355512339|gb|AES93962.1| Ethylene-responsive transcription factor ERF061 [Medicago truncatula] Length = 320 Score = 61.6 bits (148), Expect = 6e-08 Identities = 34/58 (58%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = -2 Query: 336 TYDSAECAAIAYDRAAYKLRGEYAQLNFPN------LGAGVGEWAERLRLTVDEKIHA 181 TY++AE AA AYDRAAYKLRGEYA+LNFPN LG G L+ +VD KI A Sbjct: 145 TYETAEAAAYAYDRAAYKLRGEYARLNFPNLKDPTKLGFGDSTRLNALKNSVDAKIQA 202