BLASTX nr result
ID: Dioscorea21_contig00035445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00035445 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546958.1| PREDICTED: putative pentatricopeptide repeat... 73 3e-11 ref|XP_003542086.1| PREDICTED: putative pentatricopeptide repeat... 70 2e-10 ref|XP_002866691.1| pentatricopeptide repeat-containing protein ... 69 5e-10 ref|NP_201383.1| pentatricopeptide repeat-containing protein [Ar... 68 7e-10 emb|CAA16678.1| predicted protein [Arabidopsis thaliana] 68 7e-10 >ref|XP_003546958.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like [Glycine max] Length = 654 Score = 72.8 bits (177), Expect = 3e-11 Identities = 38/63 (60%), Positives = 47/63 (74%), Gaps = 3/63 (4%) Frame = -1 Query: 181 LIAIQTLT---TSDHALHDDFSSDVENIYRILRKFHSRPDKLHLALHDSGAPLRPGLVER 11 LI +Q ++ T DH HD+F+SDVE +YRILRK+HSR KL LAL +SG +RPGL ER Sbjct: 69 LIRLQEISINHTDDHT-HDEFASDVEKVYRILRKYHSRVPKLELALRESGVVVRPGLTER 127 Query: 10 VLS 2 VLS Sbjct: 128 VLS 130 >ref|XP_003542086.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like [Glycine max] Length = 628 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = -1 Query: 166 TLTTSDHALHDDFSSDVENIYRILRKFHSRPDKLHLALHDSGAPLRPGLVERVLS 2 ++ +D HD+F+SDVE +YRILRK+HSR KL LAL +SG +RPGL ERVL+ Sbjct: 50 SINHTDDQTHDEFASDVEKVYRILRKYHSRVPKLELALRESGVVVRPGLTERVLN 104 >ref|XP_002866691.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312526|gb|EFH42950.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 638 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -1 Query: 139 HDDFSSDVENIYRILRKFHSRPDKLHLALHDSGAPLRPGLVERVLS 2 +D+F+SDVE YRILRKFHSR KL LAL++SG LRPGL+ERVL+ Sbjct: 77 YDEFASDVEKAYRILRKFHSRVPKLELALNESGVELRPGLIERVLN 122 >ref|NP_201383.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170571|sp|Q9FH87.1|PP447_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g65820 gi|9758569|dbj|BAB09050.1| unnamed protein product [Arabidopsis thaliana] gi|332010728|gb|AED98111.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 637 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -1 Query: 139 HDDFSSDVENIYRILRKFHSRPDKLHLALHDSGAPLRPGLVERVLS 2 +D+F+SDVE YRILRKFHSR KL LAL++SG LRPGL+ERVL+ Sbjct: 76 YDEFASDVEKSYRILRKFHSRVPKLELALNESGVELRPGLIERVLN 121 >emb|CAA16678.1| predicted protein [Arabidopsis thaliana] Length = 598 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -1 Query: 139 HDDFSSDVENIYRILRKFHSRPDKLHLALHDSGAPLRPGLVERVLS 2 +D+F+SDVE YRILRKFHSR KL LAL++SG LRPGL+ERVL+ Sbjct: 69 YDEFASDVEKSYRILRKFHSRVPKLELALNESGVELRPGLIERVLN 114