BLASTX nr result
ID: Dioscorea21_contig00035284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00035284 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW67094.1| hypothetical protein ZEAMMB73_362131 [Zea mays] 56 3e-06 >gb|AFW67094.1| hypothetical protein ZEAMMB73_362131 [Zea mays] Length = 134 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 8/84 (9%) Frame = -2 Query: 229 MGSLMAGWASCVLHDEKERLERNKSLTKAEIETYWKLH--------QXXXXXXXXXXKSK 74 MGSLM+GW+S VL D++ RL RN+SLTK E+ +W+ H +S Sbjct: 1 MGSLMSGWSSSVLSDKEARLMRNRSLTKEEVAAFWRQHGSIPNAGSPRAVPVQYCCTRSD 60 Query: 73 DDSNFLXXXXXENKNNRTTDWWTK 2 DD FL ++ WWT+ Sbjct: 61 DDGFFLPENAADSSAANRGSWWTR 84