BLASTX nr result
ID: Dioscorea21_contig00035122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00035122 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP49820.1| ethylene responsive transcription factor 6 [Triti... 59 4e-07 ref|XP_002460334.1| hypothetical protein SORBIDRAFT_02g026630 [S... 56 3e-06 ref|XP_003607977.1| Ethylene-responsive transcription factor [Me... 54 1e-05 >gb|AFP49820.1| ethylene responsive transcription factor 6 [Triticum durum] Length = 251 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/53 (47%), Positives = 39/53 (73%), Gaps = 3/53 (5%) Frame = -1 Query: 249 SQDQEQAIIISSLVHVICGDTSPATTIPGFFLP---QPCSTCGINGCLGCDLF 100 S +QEQ++++++L+HV+ G T+PA P FF P + CS CG++GCLGC+ F Sbjct: 36 SPEQEQSVLVAALLHVVSGYTTPA---PAFFFPASKEACSACGMDGCLGCEFF 85 >ref|XP_002460334.1| hypothetical protein SORBIDRAFT_02g026630 [Sorghum bicolor] gi|241923711|gb|EER96855.1| hypothetical protein SORBIDRAFT_02g026630 [Sorghum bicolor] Length = 294 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/52 (46%), Positives = 34/52 (65%) Frame = -1 Query: 255 LCSQDQEQAIIISSLVHVICGDTSPATTIPGFFLPQPCSTCGINGCLGCDLF 100 L S +QE AII+++L HV+ G ++P + +PC CGI+GCLGCD F Sbjct: 49 LISHEQEDAIIVAALRHVVSGYSTPPPEVVTVAGGEPCGVCGIDGCLGCDFF 100 >ref|XP_003607977.1| Ethylene-responsive transcription factor [Medicago truncatula] gi|355509032|gb|AES90174.1| Ethylene-responsive transcription factor [Medicago truncatula] Length = 466 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 18/80 (22%) Frame = -1 Query: 282 NKTSELMTSLCSQDQEQAIIISSLVHVICGDTSPATTIPGFFLP---------------- 151 N +S +S DQEQ++I+++L V+ G TS A ++P F LP Sbjct: 3 NSSSSFSSSTLPSDQEQSVIVTALTKVVSGSTSTANSLPEFHLPDSTIGSSSSMERIPPT 62 Query: 150 --QPCSTCGINGCLGCDLFA 97 + C C I GCLGC+ F+ Sbjct: 63 NMETCRECNIAGCLGCNFFS 82