BLASTX nr result
ID: Dioscorea21_contig00035089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00035089 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007476005.1| hypothetical chloroplast RF21 [Bismarckia no... 58 9e-07 gb|AEK71813.1| hypothetical chloroplast RF2 [Aristolochia littor... 57 1e-06 gb|AEZ48749.1| hypothetical chloroplast RF2, partial [Pitcairnia... 57 2e-06 gb|AEZ48745.1| hypothetical chloroplast RF2, partial [Navia saxi... 57 2e-06 gb|AEZ48739.1| hypothetical chloroplast RF2, partial [Fosterella... 57 2e-06 >ref|YP_007476005.1| hypothetical chloroplast RF21 [Bismarckia nobilis] gi|456061832|ref|YP_007476022.1| hypothetical chloroplast RF21 [Bismarckia nobilis] gi|449326487|gb|AGE93069.1| hypothetical chloroplast RF21 [Bismarckia nobilis] gi|449326506|gb|AGE93088.1| hypothetical chloroplast RF21 [Bismarckia nobilis] Length = 2293 Score = 57.8 bits (138), Expect = 9e-07 Identities = 35/66 (53%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = +3 Query: 153 AKERSMKGGEGEVQLQTKILTNVKPNSRIW---------SKNDSGYEMIEPPGSIYLRYL 305 A S+ E E +Q LT K RI SKNDSGY+MIE PGSIYLRYL Sbjct: 1513 ANSDSIDDEEREFLVQFSTLTTEKRIDRILLSLTHSDHLSKNDSGYQMIEQPGSIYLRYL 1572 Query: 306 VDIHKK 323 VDIHKK Sbjct: 1573 VDIHKK 1578 >gb|AEK71813.1| hypothetical chloroplast RF2 [Aristolochia littoralis] Length = 2247 Score = 57.4 bits (137), Expect = 1e-06 Identities = 35/66 (53%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = +3 Query: 153 AKERSMKGGEGEVQLQTKILTNVKPNSRIW---------SKNDSGYEMIEPPGSIYLRYL 305 A S+ E E +Q LT K +I SKNDSGYEMIE PGSIYLRYL Sbjct: 1463 ANSDSIDDEEREFLVQFSTLTTEKRIDQILLSLTHSDHLSKNDSGYEMIEEPGSIYLRYL 1522 Query: 306 VDIHKK 323 VDIHKK Sbjct: 1523 VDIHKK 1528 >gb|AEZ48749.1| hypothetical chloroplast RF2, partial [Pitcairnia feliciana] Length = 2291 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +3 Query: 204 KILTNVKPNSRIWSKNDSGYEMIEPPGSIYLRYLVDIHKK 323 +IL ++ N + SKNDSGY+MIE PGSIYLRYLVDIHKK Sbjct: 1538 QILLSLTHNDHL-SKNDSGYQMIEQPGSIYLRYLVDIHKK 1576 >gb|AEZ48745.1| hypothetical chloroplast RF2, partial [Navia saxicola] Length = 2291 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +3 Query: 204 KILTNVKPNSRIWSKNDSGYEMIEPPGSIYLRYLVDIHKK 323 +IL ++ N + SKNDSGY+MIE PGSIYLRYLVDIHKK Sbjct: 1538 QILLSLTHNDHL-SKNDSGYQMIEQPGSIYLRYLVDIHKK 1576 >gb|AEZ48739.1| hypothetical chloroplast RF2, partial [Fosterella caulescens] Length = 2284 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +3 Query: 204 KILTNVKPNSRIWSKNDSGYEMIEPPGSIYLRYLVDIHKK 323 +IL ++ N + SKNDSGY+MIE PGSIYLRYLVDIHKK Sbjct: 1531 QILLSLTHNDHL-SKNDSGYQMIEQPGSIYLRYLVDIHKK 1569