BLASTX nr result
ID: Dioscorea21_contig00034285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00034285 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527729.1| acetylglucosaminyltransferase, putative [Ric... 57 2e-06 >ref|XP_002527729.1| acetylglucosaminyltransferase, putative [Ricinus communis] gi|223532870|gb|EEF34642.1| acetylglucosaminyltransferase, putative [Ricinus communis] Length = 389 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/46 (58%), Positives = 34/46 (73%), Gaps = 4/46 (8%) Frame = +3 Query: 129 PSPNPLKLDRWI----PKLPRLAYLISGSKGDGKRVKRLLRAMYHP 254 P+ K+ W PKLPR AYLISG+KGDG+RVKRL++A+YHP Sbjct: 22 PNQPKAKIPDWSLSDQPKLPRFAYLISGTKGDGERVKRLVQAVYHP 67