BLASTX nr result
ID: Dioscorea21_contig00033681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00033681 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 121 7e-26 ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containi... 120 9e-26 emb|CBI14948.3| unnamed protein product [Vitis vinifera] 118 6e-25 ref|XP_002277458.1| PREDICTED: pentatricopeptide repeat-containi... 118 6e-25 gb|AFW58607.1| hypothetical protein ZEAMMB73_481408 [Zea mays] 116 2e-24 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 121 bits (303), Expect = 7e-26 Identities = 53/65 (81%), Positives = 59/65 (90%) Frame = +2 Query: 2 LAIAFGLIKSQPGSVIRVSKNLRVCTDCHLATKLISKVYQRDIIVRDRNRFHHFRDGDCS 181 LAIAFGL+K PG+ IR+SKNLRVCTDCH ATKLISKVY R+I+VRDRNRFHHF+DG CS Sbjct: 629 LAIAFGLMKLDPGATIRLSKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDGTCS 688 Query: 182 CNDYW 196 CNDYW Sbjct: 689 CNDYW 693 >ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Brachypodium distachyon] Length = 745 Score = 120 bits (302), Expect = 9e-26 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = +2 Query: 2 LAIAFGLIKSQPGSVIRVSKNLRVCTDCHLATKLISKVYQRDIIVRDRNRFHHFRDGDCS 181 LAIAFGL+KS+PG+ IR+SKNLRVC DCH ATKLISKVY R+IIVRDRNRFHHF+DG CS Sbjct: 681 LAIAFGLMKSRPGATIRLSKNLRVCIDCHSATKLISKVYNREIIVRDRNRFHHFKDGLCS 740 Query: 182 CNDYW 196 CNDYW Sbjct: 741 CNDYW 745 >emb|CBI14948.3| unnamed protein product [Vitis vinifera] Length = 401 Score = 118 bits (295), Expect = 6e-25 Identities = 50/65 (76%), Positives = 59/65 (90%) Frame = +2 Query: 2 LAIAFGLIKSQPGSVIRVSKNLRVCTDCHLATKLISKVYQRDIIVRDRNRFHHFRDGDCS 181 LAIAFGLIKS PG+ IR++KNLRVCTDCH ATKL+SKV+ R+I+VRDR RFHHF++G CS Sbjct: 337 LAIAFGLIKSPPGTTIRITKNLRVCTDCHNATKLVSKVFNREIVVRDRTRFHHFKEGSCS 396 Query: 182 CNDYW 196 CNDYW Sbjct: 397 CNDYW 401 >ref|XP_002277458.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 [Vitis vinifera] Length = 698 Score = 118 bits (295), Expect = 6e-25 Identities = 50/65 (76%), Positives = 59/65 (90%) Frame = +2 Query: 2 LAIAFGLIKSQPGSVIRVSKNLRVCTDCHLATKLISKVYQRDIIVRDRNRFHHFRDGDCS 181 LAIAFGLIKS PG+ IR++KNLRVCTDCH ATKL+SKV+ R+I+VRDR RFHHF++G CS Sbjct: 634 LAIAFGLIKSPPGTTIRITKNLRVCTDCHNATKLVSKVFNREIVVRDRTRFHHFKEGSCS 693 Query: 182 CNDYW 196 CNDYW Sbjct: 694 CNDYW 698 >gb|AFW58607.1| hypothetical protein ZEAMMB73_481408 [Zea mays] Length = 694 Score = 116 bits (290), Expect = 2e-24 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = +2 Query: 2 LAIAFGLIKSQPGSVIRVSKNLRVCTDCHLATKLISKVYQRDIIVRDRNRFHHFRDGDCS 181 LAIAFGL+K PG+ IR+SKNLRVC DCH ATKLISKVY R+I+VRDRN FHHF+DG CS Sbjct: 630 LAIAFGLMKLDPGATIRLSKNLRVCADCHSATKLISKVYDREIVVRDRNIFHHFKDGTCS 689 Query: 182 CNDYW 196 CNDYW Sbjct: 690 CNDYW 694