BLASTX nr result
ID: Dioscorea21_contig00032977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032977 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001044383.1| Os01g0771200 [Oryza sativa Japonica Group] g... 56 4e-06 ref|XP_002456413.1| hypothetical protein SORBIDRAFT_03g035880 [S... 55 8e-06 >ref|NP_001044383.1| Os01g0771200 [Oryza sativa Japonica Group] gi|53791372|dbj|BAD52724.1| putative Mal d 1-associated protein [Oryza sativa Japonica Group] gi|113533914|dbj|BAF06297.1| Os01g0771200 [Oryza sativa Japonica Group] gi|125572176|gb|EAZ13691.1| hypothetical protein OsJ_03613 [Oryza sativa Japonica Group] gi|215741120|dbj|BAG97615.1| unnamed protein product [Oryza sativa Japonica Group] Length = 198 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/53 (49%), Positives = 31/53 (58%) Frame = +1 Query: 1 FNLPGFQSEIEAIERGLSGGFSRILDAAEEMANDIFNSLNIPYFRTRESPSFD 159 F PG +S+IEA+E+GL G LD AE M ND S +P RES SFD Sbjct: 106 FAFPGLRSDIEALEKGLFGSIGSFLDDAERMTNDFLKSFGVPSINERESSSFD 158 >ref|XP_002456413.1| hypothetical protein SORBIDRAFT_03g035880 [Sorghum bicolor] gi|241928388|gb|EES01533.1| hypothetical protein SORBIDRAFT_03g035880 [Sorghum bicolor] Length = 188 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/76 (39%), Positives = 41/76 (53%), Gaps = 3/76 (3%) Frame = +1 Query: 1 FNLPGFQSEIEAIERGLSGGFSRILDAAEEMANDIFNSLNIPYFRTRESPSFDR--AERQ 174 F PG +S++EA+E+ G +LD AE M N S P RES F R AE+ Sbjct: 105 FAFPGLRSDMEALEKDFFGSLGNVLDEAERMTNSFIKSFGFPPVHDRESSPFRRQPAEKH 164 Query: 175 SEQDVSKK-HDSPYSE 219 E+D ++K +S YSE Sbjct: 165 IEEDTARKTKESDYSE 180