BLASTX nr result
ID: Dioscorea21_contig00032970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032970 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301427.1| predicted protein [Populus trichocarpa] gi|2... 96 2e-18 ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 emb|CBI40590.3| unnamed protein product [Vitis vinifera] 94 2e-17 emb|CAN66974.1| hypothetical protein VITISV_022076 [Vitis vinifera] 94 2e-17 ref|XP_004155716.1| PREDICTED: pentatricopeptide repeat-containi... 93 2e-17 >ref|XP_002301427.1| predicted protein [Populus trichocarpa] gi|222843153|gb|EEE80700.1| predicted protein [Populus trichocarpa] Length = 442 Score = 96.3 bits (238), Expect = 2e-18 Identities = 43/76 (56%), Positives = 60/76 (78%) Frame = +3 Query: 3 KVFDEMPHRDVASWNSLLDGYAKSGDLMRAQELFDSMPVRNVISWTSMVAGFCQNGRYED 182 +VFDEM RD+ +WNSL+ GY++SGD+ A ELF MP R+V+SWT+M++G+ QNG Y Sbjct: 66 QVFDEMTVRDIPTWNSLIAGYSRSGDMEGALELFKLMPSRSVVSWTTMISGYSQNGMYTK 125 Query: 183 ALQVFVKMLEDCEVRP 230 AL++F+KM +D EVRP Sbjct: 126 ALEMFLKMEKDKEVRP 141 >ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Vitis vinifera] Length = 512 Score = 93.6 bits (231), Expect = 2e-17 Identities = 43/76 (56%), Positives = 56/76 (73%) Frame = +3 Query: 3 KVFDEMPHRDVASWNSLLDGYAKSGDLMRAQELFDSMPVRNVISWTSMVAGFCQNGRYED 182 K FDEM RDV +WNS++ GYA+ GDL A ELF MP RNV SWT+M++G+ QNG+Y Sbjct: 138 KQFDEMTVRDVPTWNSMIAGYARCGDLEGALELFRLMPARNVTSWTAMISGYAQNGQYAK 197 Query: 183 ALQVFVKMLEDCEVRP 230 AL +F+ M E+ E+RP Sbjct: 198 ALSMFLMMEEETEMRP 213 >emb|CBI40590.3| unnamed protein product [Vitis vinifera] Length = 495 Score = 93.6 bits (231), Expect = 2e-17 Identities = 43/76 (56%), Positives = 56/76 (73%) Frame = +3 Query: 3 KVFDEMPHRDVASWNSLLDGYAKSGDLMRAQELFDSMPVRNVISWTSMVAGFCQNGRYED 182 K FDEM RDV +WNS++ GYA+ GDL A ELF MP RNV SWT+M++G+ QNG+Y Sbjct: 138 KQFDEMTVRDVPTWNSMIAGYARCGDLEGALELFRLMPARNVTSWTAMISGYAQNGQYAK 197 Query: 183 ALQVFVKMLEDCEVRP 230 AL +F+ M E+ E+RP Sbjct: 198 ALSMFLMMEEETEMRP 213 >emb|CAN66974.1| hypothetical protein VITISV_022076 [Vitis vinifera] Length = 967 Score = 93.6 bits (231), Expect = 2e-17 Identities = 43/76 (56%), Positives = 56/76 (73%) Frame = +3 Query: 3 KVFDEMPHRDVASWNSLLDGYAKSGDLMRAQELFDSMPVRNVISWTSMVAGFCQNGRYED 182 K FDEM RDV +WNS++ GYA+ GDL A ELF MP RNV SWT+M++G+ QNG+Y Sbjct: 623 KQFDEMTVRDVPTWNSMIAGYARCGDLEGALELFRLMPARNVTSWTAMISGYAQNGQYAK 682 Query: 183 ALQVFVKMLEDCEVRP 230 AL +F+ M E+ E+RP Sbjct: 683 ALSMFLMMEEETEMRP 698 >ref|XP_004155716.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Cucumis sativus] Length = 512 Score = 93.2 bits (230), Expect = 2e-17 Identities = 39/76 (51%), Positives = 59/76 (77%) Frame = +3 Query: 3 KVFDEMPHRDVASWNSLLDGYAKSGDLMRAQELFDSMPVRNVISWTSMVAGFCQNGRYED 182 ++FDEMP RD+ +WNSL+ GYA+SG + A ELF+ MPVRNVISWT++++G+ QNG+Y Sbjct: 138 QLFDEMPVRDIPTWNSLIAGYARSGHMEAALELFNKMPVRNVISWTALISGYAQNGKYAK 197 Query: 183 ALQVFVKMLEDCEVRP 230 AL++F+ + + +P Sbjct: 198 ALEMFIGLENEKGTKP 213 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/59 (47%), Positives = 43/59 (72%) Frame = +3 Query: 30 DVASWNSLLDGYAKSGDLMRAQELFDSMPVRNVISWTSMVAGFCQNGRYEDALQVFVKM 206 D+ + +LLD YAK G L A++LFD MPVR++ +W S++AG+ ++G E AL++F KM Sbjct: 116 DMFAMTALLDMYAKLGMLRSARQLFDEMPVRDIPTWNSLIAGYARSGHMEAALELFNKM 174