BLASTX nr result
ID: Dioscorea21_contig00032962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032962 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003574702.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_003574702.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80150, mitochondrial-like [Brachypodium distachyon] Length = 448 Score = 55.1 bits (131), Expect = 6e-06 Identities = 33/56 (58%), Positives = 36/56 (64%) Frame = +3 Query: 201 MLSLRNIRRVCAAIDTVVLTVIAANLSKLRARSDLAAPSSAQIPESFPTIASCAAA 368 MLSL IR++CAA D V LTVIAA LS R+R A S P FPTIASC AA Sbjct: 1 MLSLGAIRKLCAAFDAVALTVIAAGLSHPRSRPFSARAHST--PHDFPTIASCRAA 54