BLASTX nr result
ID: Dioscorea21_contig00032893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032893 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_04532941.1| conserved hypothetical protein [Escherichia s... 58 9e-07 >ref|ZP_04532941.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] gi|226903374|gb|EEH89633.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] Length = 66 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -3 Query: 109 MTP*PKQCSTPNGVRPRRYLNSFRGEPAITEFD*PF 2 MTP PKQCSTP RRYLNSFRGEPAI+ FD PF Sbjct: 1 MTPLPKQCSTPGDEFTRRYLNSFRGEPAISRFDWPF 36