BLASTX nr result
ID: Dioscorea21_contig00032748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032748 (526 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304264.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 ref|XP_004155062.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_003572243.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_002877566.1| pentatricopeptide repeat-containing protein ... 89 3e-16 ref|XP_002445550.1| hypothetical protein SORBIDRAFT_07g021340 [S... 89 3e-16 >ref|XP_002304264.1| predicted protein [Populus trichocarpa] gi|222841696|gb|EEE79243.1| predicted protein [Populus trichocarpa] Length = 499 Score = 90.1 bits (222), Expect = 2e-16 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 526 IAKNLRTCIDCHTFSKVLSSVYNRVVVIRDRSRFHHFKDGHCSCNDYW 383 IAKNLR C+DCH F+K+LS VYNR V+I D +RFHHF+ GHCSCNDYW Sbjct: 452 IAKNLRICVDCHNFAKILSGVYNRQVIITDHTRFHHFRGGHCSCNDYW 499 >ref|XP_004155062.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Cucumis sativus] Length = 602 Score = 89.7 bits (221), Expect = 2e-16 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -1 Query: 526 IAKNLRTCIDCHTFSKVLSSVYNRVVVIRDRSRFHHFKDGHCSCNDYW 383 IA N+RTC+DCH F+K +SSVYNR VV+RDRSRFHHF++G CSCND+W Sbjct: 555 IANNIRTCMDCHNFAKYISSVYNRKVVVRDRSRFHHFQEGRCSCNDFW 602 >ref|XP_003572243.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Brachypodium distachyon] Length = 884 Score = 89.7 bits (221), Expect = 2e-16 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -1 Query: 526 IAKNLRTCIDCHTFSKVLSSVYNRVVVIRDRSRFHHFKDGHCSCNDYW 383 +AKNLR C+DCH F+KV S VYNR+V++RDR+RFHHF G CSCNDYW Sbjct: 837 LAKNLRVCVDCHNFTKVFSGVYNRLVIVRDRTRFHHFNGGQCSCNDYW 884 >ref|XP_002877566.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323404|gb|EFH53825.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 591 Score = 89.4 bits (220), Expect = 3e-16 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -1 Query: 526 IAKNLRTCIDCHTFSKVLSSVYNRVVVIRDRSRFHHFKDGHCSCNDYW 383 + KNLRTC+DCH F+K +S VY+RVV++RDRSRFHHFK G CSCND+W Sbjct: 544 VTKNLRTCVDCHNFAKFVSDVYDRVVIVRDRSRFHHFKGGSCSCNDFW 591 >ref|XP_002445550.1| hypothetical protein SORBIDRAFT_07g021340 [Sorghum bicolor] gi|241941900|gb|EES15045.1| hypothetical protein SORBIDRAFT_07g021340 [Sorghum bicolor] Length = 595 Score = 89.4 bits (220), Expect = 3e-16 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = -1 Query: 526 IAKNLRTCIDCHTFSKVLSSVYNRVVVIRDRSRFHHFKDGHCSCNDYW 383 +AKNLR C+DCH F+KV S +YNR+V++RDR+RFHHF+ G CSCNDYW Sbjct: 548 LAKNLRVCVDCHNFTKVFSGIYNRLVIVRDRTRFHHFQGGKCSCNDYW 595