BLASTX nr result
ID: Dioscorea21_contig00032685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032685 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003565650.1| PREDICTED: uncharacterized protein LOC100831... 124 6e-27 dbj|BAK04576.1| predicted protein [Hordeum vulgare subsp. vulgare] 122 2e-26 ref|XP_002457642.1| hypothetical protein SORBIDRAFT_03g011030 [S... 119 3e-25 gb|AFW79547.1| hypothetical protein ZEAMMB73_613442 [Zea mays] 116 2e-24 gb|AFW79546.1| hypothetical protein ZEAMMB73_613442 [Zea mays] 116 2e-24 >ref|XP_003565650.1| PREDICTED: uncharacterized protein LOC100831527 [Brachypodium distachyon] Length = 961 Score = 124 bits (312), Expect = 6e-27 Identities = 58/94 (61%), Positives = 74/94 (78%), Gaps = 1/94 (1%) Frame = -3 Query: 285 RFWNGVQWVIAPHELPTSAGHAVSVFIVNQTILSLSEAGLLYQLQLNEHTQPIWTKLELI 106 RFWNGV WVIAPHELPTSAG+A + FIVN TIL+LSEAG+LYQLQLNEH QPIWT++ Sbjct: 174 RFWNGVMWVIAPHELPTSAGYATATFIVNTTILALSEAGILYQLQLNEHAQPIWTEMTFT 233 Query: 105 SEANMDD-ARKEESPFLQIKSGLVSHDGERLYVT 7 SE + + K +S IK+G+VSH+G +L+++ Sbjct: 234 SEQHFTNLGEKTQSQATHIKNGIVSHNGRKLFLS 267 >dbj|BAK04576.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 364 Score = 122 bits (307), Expect = 2e-26 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 1/96 (1%) Frame = -3 Query: 285 RFWNGVQWVIAPHELPTSAGHAVSVFIVNQTILSLSEAGLLYQLQLNEHTQPIWTKLELI 106 RFWNGV WVIAPHELPT+AG+A + FIVN TIL+LSEAG+LYQLQLNEH QPIWT++ Sbjct: 164 RFWNGVMWVIAPHELPTAAGYATATFIVNTTILALSEAGILYQLQLNEHAQPIWTEITFS 223 Query: 105 SEANMDD-ARKEESPFLQIKSGLVSHDGERLYVTTT 1 E + + K +S IK+G+VSH+G +L+++ T Sbjct: 224 YEQHFTNLGEKTQSQATHIKNGIVSHNGRKLFLSAT 259 >ref|XP_002457642.1| hypothetical protein SORBIDRAFT_03g011030 [Sorghum bicolor] gi|241929617|gb|EES02762.1| hypothetical protein SORBIDRAFT_03g011030 [Sorghum bicolor] Length = 945 Score = 119 bits (298), Expect = 3e-25 Identities = 55/94 (58%), Positives = 74/94 (78%), Gaps = 1/94 (1%) Frame = -3 Query: 285 RFWNGVQWVIAPHELPTSAGHAVSVFIVNQTILSLSEAGLLYQLQLNEHTQPIWTKLELI 106 RFWNGV WVIAPHELPTSAG+A++ FIVN TIL+LSEAG+LYQLQLNEH QPIWT++ Sbjct: 147 RFWNGVMWVIAPHELPTSAGYAIATFIVNTTILALSEAGILYQLQLNEHAQPIWTEMTFN 206 Query: 105 SEANMDD-ARKEESPFLQIKSGLVSHDGERLYVT 7 S + K +S ++I++G+ S+DG +L+++ Sbjct: 207 SGQQFTNLGLKTQSQAMRIRNGIASNDGRKLFLS 240 >gb|AFW79547.1| hypothetical protein ZEAMMB73_613442 [Zea mays] Length = 920 Score = 116 bits (291), Expect = 2e-24 Identities = 55/94 (58%), Positives = 74/94 (78%), Gaps = 1/94 (1%) Frame = -3 Query: 285 RFWNGVQWVIAPHELPTSAGHAVSVFIVNQTILSLSEAGLLYQLQLNEHTQPIWTKLEL- 109 RFWNGV WVIAPHELP SAG+A + FIVN TIL+LSEAG LYQLQLNEH QPIWT++ Sbjct: 152 RFWNGVVWVIAPHELPASAGYATATFIVNTTILALSEAGTLYQLQLNEHAQPIWTEMAFN 211 Query: 108 ISEANMDDARKEESPFLQIKSGLVSHDGERLYVT 7 S+ + + K +S ++I++G+VS+DG +L+++ Sbjct: 212 SSQQSANLGLKTQSQAMRIRNGIVSNDGRKLFLS 245 >gb|AFW79546.1| hypothetical protein ZEAMMB73_613442 [Zea mays] Length = 767 Score = 116 bits (291), Expect = 2e-24 Identities = 55/94 (58%), Positives = 74/94 (78%), Gaps = 1/94 (1%) Frame = -3 Query: 285 RFWNGVQWVIAPHELPTSAGHAVSVFIVNQTILSLSEAGLLYQLQLNEHTQPIWTKLEL- 109 RFWNGV WVIAPHELP SAG+A + FIVN TIL+LSEAG LYQLQLNEH QPIWT++ Sbjct: 152 RFWNGVVWVIAPHELPASAGYATATFIVNTTILALSEAGTLYQLQLNEHAQPIWTEMAFN 211 Query: 108 ISEANMDDARKEESPFLQIKSGLVSHDGERLYVT 7 S+ + + K +S ++I++G+VS+DG +L+++ Sbjct: 212 SSQQSANLGLKTQSQAMRIRNGIVSNDGRKLFLS 245