BLASTX nr result
ID: Dioscorea21_contig00032648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032648 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002876202.1| pentatricopeptide repeat-containing protein ... 77 1e-12 ref|XP_003632631.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 emb|CAN61725.1| hypothetical protein VITISV_032420 [Vitis vinifera] 75 4e-12 ref|NP_190904.1| pentatricopeptide repeat-containing protein [Ar... 75 7e-12 ref|XP_003553542.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 >ref|XP_002876202.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322040|gb|EFH52461.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 769 Score = 77.4 bits (189), Expect = 1e-12 Identities = 38/64 (59%), Positives = 48/64 (75%) Frame = -1 Query: 193 HRRLSNSLVLTDVILHNHILNAYGKCRSLDDALQLFDTMPERNLVTWTSVISGLSQNHRE 14 H + NS D IL+NHIL+ YGKC SL DA ++FD MPERNLV++TSVI+G SQN +E Sbjct: 87 HDHILNSNCKYDTILNNHILSMYGKCGSLRDAREVFDFMPERNLVSYTSVITGYSQNGQE 146 Query: 13 REAV 2 EA+ Sbjct: 147 AEAI 150 >ref|XP_003632631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Vitis vinifera] Length = 755 Score = 77.0 bits (188), Expect = 1e-12 Identities = 39/79 (49%), Positives = 48/79 (60%) Frame = -1 Query: 259 STYAQLFXXXXXXXXXXXXXXLHRRLSNSLVLTDVILHNHILNAYGKCRSLDDALQLFDT 80 STYA L +H + S D+ L NHILN YGKC+SL DA ++FD Sbjct: 64 STYAYLISACSYLRSLEHGKKIHDHMLKSKSHPDLTLQNHILNMYGKCKSLKDAQKVFDA 123 Query: 79 MPERNLVTWTSVISGLSQN 23 MPERN+V+WTSVI+G SQN Sbjct: 124 MPERNVVSWTSVIAGYSQN 142 >emb|CAN61725.1| hypothetical protein VITISV_032420 [Vitis vinifera] Length = 763 Score = 75.5 bits (184), Expect = 4e-12 Identities = 39/79 (49%), Positives = 47/79 (59%) Frame = -1 Query: 259 STYAQLFXXXXXXXXXXXXXXLHRRLSNSLVLTDVILHNHILNAYGKCRSLDDALQLFDT 80 STYA L +H + S D+ L NHILN YGKC SL DA ++FD Sbjct: 64 STYAYLISACSYLRSLEHGRKIHDHMLKSKSHPDLTLQNHILNMYGKCGSLKDAQKVFDA 123 Query: 79 MPERNLVTWTSVISGLSQN 23 MPERN+V+WTSVI+G SQN Sbjct: 124 MPERNVVSWTSVIAGYSQN 142 >ref|NP_190904.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75174119|sp|Q9LFI1.1|PP280_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g53360, mitochondrial; Flags: Precursor gi|6729487|emb|CAB67643.1| putative protein [Arabidopsis thaliana] gi|332645554|gb|AEE79075.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 768 Score = 74.7 bits (182), Expect = 7e-12 Identities = 37/64 (57%), Positives = 47/64 (73%) Frame = -1 Query: 193 HRRLSNSLVLTDVILHNHILNAYGKCRSLDDALQLFDTMPERNLVTWTSVISGLSQNHRE 14 H + NS D IL+NHIL+ YGKC SL DA ++FD MPERNLV++TSVI+G SQN + Sbjct: 90 HDHILNSNCKYDTILNNHILSMYGKCGSLRDAREVFDFMPERNLVSYTSVITGYSQNGQG 149 Query: 13 REAV 2 EA+ Sbjct: 150 AEAI 153 >ref|XP_003553542.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Glycine max] Length = 777 Score = 74.7 bits (182), Expect = 7e-12 Identities = 38/87 (43%), Positives = 50/87 (57%) Frame = -1 Query: 262 PSTYAQLFXXXXXXXXXXXXXXLHRRLSNSLVLTDVILHNHILNAYGKCRSLDDALQLFD 83 PSTY L +H + S D++L NHILN YGKC SL DA + FD Sbjct: 80 PSTYVNLILACTNVRSLKYGKRIHDHILKSNCQPDLVLQNHILNMYGKCGSLKDARKAFD 139 Query: 82 TMPERNLVTWTSVISGLSQNHREREAV 2 TM R++V+WT +ISG SQN +E +A+ Sbjct: 140 TMQLRSVVSWTIMISGYSQNGQENDAI 166