BLASTX nr result
ID: Dioscorea21_contig00032554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00032554 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304822.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_002275846.1| PREDICTED: transcription factor GAMYB [Vitis... 69 4e-10 emb|CAN78897.1| hypothetical protein VITISV_025421 [Vitis vinifera] 69 4e-10 dbj|BAJ61445.1| R2R3-MYB transcription factor [Lupinus albus] 67 1e-09 ref|XP_002525574.1| r2r3-myb transcription factor, putative [Ric... 64 1e-08 >ref|XP_002304822.1| predicted protein [Populus trichocarpa] gi|222842254|gb|EEE79801.1| predicted protein [Populus trichocarpa] Length = 558 Score = 71.2 bits (173), Expect = 8e-11 Identities = 39/80 (48%), Positives = 46/80 (57%), Gaps = 4/80 (5%) Frame = +2 Query: 2 WNTRIKRRQRAGLPLHPPPLCFQASNYSQNNHTENEFSSHNKEKNE----KPIDIPAFMF 169 WNTRIKRRQRAGLPL+PP + Q SQ N S NK +++ IP MF Sbjct: 133 WNTRIKRRQRAGLPLYPPEVSLQTLQGSQQCLDINGMDSGNKGQHDILQTHNYGIPDVMF 192 Query: 170 DNLKGNRGYVPYTPPFPENS 229 DNLK NR +PY P P+ S Sbjct: 193 DNLKTNRSILPYVPELPDIS 212 >ref|XP_002275846.1| PREDICTED: transcription factor GAMYB [Vitis vinifera] gi|298205121|emb|CBI40642.3| unnamed protein product [Vitis vinifera] Length = 559 Score = 68.9 bits (167), Expect = 4e-10 Identities = 35/80 (43%), Positives = 44/80 (55%), Gaps = 4/80 (5%) Frame = +2 Query: 2 WNTRIKRRQRAGLPLHPPPLCFQASNYSQNNHTENEFSSHNKEKNE----KPIDIPAFMF 169 WNTRIKRRQRAGLPL+PP +CFQA SQ + +K ++ +IP + Sbjct: 134 WNTRIKRRQRAGLPLYPPEVCFQALQESQQIQNTGGINGGDKVHHDLLQTNSYEIPDVIL 193 Query: 170 DNLKGNRGYVPYTPPFPENS 229 D K N+ PY P FP S Sbjct: 194 DGFKANQDAFPYVPDFPNLS 213 >emb|CAN78897.1| hypothetical protein VITISV_025421 [Vitis vinifera] Length = 455 Score = 68.9 bits (167), Expect = 4e-10 Identities = 35/80 (43%), Positives = 44/80 (55%), Gaps = 4/80 (5%) Frame = +2 Query: 2 WNTRIKRRQRAGLPLHPPPLCFQASNYSQNNHTENEFSSHNKEKNE----KPIDIPAFMF 169 WNTRIKRRQRAGLPL+PP +CFQA SQ + +K ++ +IP + Sbjct: 30 WNTRIKRRQRAGLPLYPPEVCFQALQESQQIQNTGGINGGDKVHHDLLQTNSYEIPDVIL 89 Query: 170 DNLKGNRGYVPYTPPFPENS 229 D K N+ PY P FP S Sbjct: 90 DGFKANQDAFPYVPDFPNLS 109 >dbj|BAJ61445.1| R2R3-MYB transcription factor [Lupinus albus] Length = 466 Score = 67.4 bits (163), Expect = 1e-09 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 2/78 (2%) Frame = +2 Query: 2 WNTRIKRRQRAGLPLHPPPLCFQASNYSQNNHTENEFSSHNKEKNE--KPIDIPAFMFDN 175 WNTRIKRRQRAGLPL+PP +C QA S + + +S NK +++ +I + D+ Sbjct: 51 WNTRIKRRQRAGLPLYPPEVCSQAFQESHQSQSTGGVNSGNKVRHDLLNSYEIHDAIIDS 110 Query: 176 LKGNRGYVPYTPPFPENS 229 +K N+G PY P P+ S Sbjct: 111 MKDNQGISPYVPEPPDIS 128 >ref|XP_002525574.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223535153|gb|EEF36833.1| r2r3-myb transcription factor, putative [Ricinus communis] Length = 556 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/74 (44%), Positives = 44/74 (59%), Gaps = 4/74 (5%) Frame = +2 Query: 2 WNTRIKRRQRAGLPLHPPPLCFQASNYSQNNHTENEFSSHNKEKNE----KPIDIPAFMF 169 WNTRIKRRQRAGLPL+PP + FQA S T ++ +K + +IP +F Sbjct: 134 WNTRIKRRQRAGLPLYPPEVSFQALQESHQGLTIGGINTGDKVHGDLLRNNGYEIPDVIF 193 Query: 170 DNLKGNRGYVPYTP 211 D+LK ++G PY P Sbjct: 194 DSLKASQGISPYVP 207