BLASTX nr result
ID: Dioscorea21_contig00031746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031746 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001143079.1| putative cytochrome P450 superfamily protein... 56 4e-06 gb|ACF82946.1| unknown [Zea mays] gi|413919205|gb|AFW59137.1| pu... 56 4e-06 >ref|NP_001143079.1| putative cytochrome P450 superfamily protein [Zea mays] gi|195613956|gb|ACG28808.1| hypothetical protein [Zea mays] gi|413919204|gb|AFW59136.1| putative cytochrome P450 superfamily protein [Zea mays] Length = 554 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/57 (42%), Positives = 37/57 (64%), Gaps = 5/57 (8%) Frame = +3 Query: 69 PTFYAFKLILRPSFAKKWRR-----RNYPPVAGTIFHQFMNLNRLQDFQTDISHKYK 224 P A L+L + + RR RNYPPVAGT+FHQ ++ RL ++QT+++H+Y+ Sbjct: 9 PALLALSLLLLALYIARRRRGGGKNRNYPPVAGTVFHQLLHFRRLMEYQTELAHRYR 65 >gb|ACF82946.1| unknown [Zea mays] gi|413919205|gb|AFW59137.1| putative cytochrome P450 superfamily protein [Zea mays] Length = 512 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/57 (42%), Positives = 37/57 (64%), Gaps = 5/57 (8%) Frame = +3 Query: 69 PTFYAFKLILRPSFAKKWRR-----RNYPPVAGTIFHQFMNLNRLQDFQTDISHKYK 224 P A L+L + + RR RNYPPVAGT+FHQ ++ RL ++QT+++H+Y+ Sbjct: 9 PALLALSLLLLALYIARRRRGGGKNRNYPPVAGTVFHQLLHFRRLMEYQTELAHRYR 65