BLASTX nr result
ID: Dioscorea21_contig00031455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031455 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005090393.1| orf192 (mitochondrion) [Phoenix dactylifera]... 89 4e-16 ref|XP_003557051.1| PREDICTED: uncharacterized protein LOC100786... 77 1e-12 ref|YP_173435.1| hypothetical protein NitaMp096 [Nicotiana tabac... 49 5e-12 ref|YP_004222268.1| hypothetical protein BevumaM_p029 [Beta vulg... 48 1e-11 ref|NP_064026.1| orf145 gene product (mitochondrion) [Beta vulga... 47 1e-11 >ref|YP_005090393.1| orf192 (mitochondrion) [Phoenix dactylifera] gi|343478445|gb|AEM43933.1| orf192 (mitochondrion) [Phoenix dactylifera] Length = 191 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 139 FGDEAFWRSQVNFGLPNPATDEKDRGSVYVVTLPAFQRCLEEG 11 FGDEAFWRSQVNFG PNPATDEKDRG VYVVTLPAFQRCLE+G Sbjct: 37 FGDEAFWRSQVNFGPPNPATDEKDRGRVYVVTLPAFQRCLEDG 79 >ref|XP_003557051.1| PREDICTED: uncharacterized protein LOC100786360 [Glycine max] Length = 83 Score = 77.4 bits (189), Expect = 1e-12 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 3/63 (4%) Frame = -1 Query: 190 RFVFVHGDGTRA*SASCFGDEAFWRSQVNFGLPNPATDEKD---RGSVYVVTLPAFQRCL 20 RFV + +G A AS DEAFWRSQVNFG PNPATDEK +GSVYVVTLPAF+RCL Sbjct: 22 RFVTLLREGRLASRAS--RDEAFWRSQVNFGPPNPATDEKAYGVKGSVYVVTLPAFKRCL 79 Query: 19 EEG 11 E+G Sbjct: 80 EDG 82 >ref|YP_173435.1| hypothetical protein NitaMp096 [Nicotiana tabacum] gi|56806599|dbj|BAD83500.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 166 Score = 48.9 bits (115), Expect(2) = 5e-12 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -1 Query: 151 SASCFGDEAFWRSQVNFGLPNPATDEK 71 ++ F DEAFWRSQVNFG PNPATDEK Sbjct: 33 ASRAFRDEAFWRSQVNFGPPNPATDEK 59 Score = 46.6 bits (109), Expect(2) = 5e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 65 GKRVRCHTPCLPKVPRGRISR 3 GKRVRCHTPCLPKVPRGR R Sbjct: 65 GKRVRCHTPCLPKVPRGRARR 85 >ref|YP_004222268.1| hypothetical protein BevumaM_p029 [Beta vulgaris subsp. maritima] gi|346683143|ref|YP_004842075.1| hypothetical protein BemaM_p027 [Beta macrocarpa] gi|54606738|dbj|BAD66761.1| orf176 [Beta vulgaris subsp. vulgaris] gi|54606773|dbj|BAD66796.1| orf176 [Beta vulgaris subsp. vulgaris] gi|317905703|emb|CBJ14092.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439783|emb|CBJ17501.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148094|emb|CBJ20755.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500061|emb|CBX24877.1| hypothetical protein [Beta macrocarpa] gi|384939206|emb|CBL52052.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 176 Score = 47.8 bits (112), Expect(2) = 1e-11 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = -1 Query: 151 SASCFGDEAFWRSQVNFGLPNPATDEK 71 ++ + DEAFWRSQVNFG PNPATDEK Sbjct: 33 ASRAYRDEAFWRSQVNFGPPNPATDEK 59 Score = 46.6 bits (109), Expect(2) = 1e-11 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 65 GKRVRCHTPCLPKVPRGRISR 3 GKRVRCHTPCLPKVPRGR R Sbjct: 65 GKRVRCHTPCLPKVPRGRARR 85 >ref|NP_064026.1| orf145 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|9049327|dbj|BAA99337.1| orf145 [Beta vulgaris subsp. vulgaris] Length = 145 Score = 47.4 bits (111), Expect(2) = 1e-11 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 139 FGDEAFWRSQVNFGLPNPATDEK 71 + DEAFWRSQVNFG PNPATDEK Sbjct: 22 YRDEAFWRSQVNFGPPNPATDEK 44 Score = 46.6 bits (109), Expect(2) = 1e-11 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 65 GKRVRCHTPCLPKVPRGRISR 3 GKRVRCHTPCLPKVPRGR R Sbjct: 50 GKRVRCHTPCLPKVPRGRARR 70