BLASTX nr result
ID: Dioscorea21_contig00031390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031390 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22620.3| unnamed protein product [Vitis vinifera] 58 7e-07 >emb|CBI22620.3| unnamed protein product [Vitis vinifera] Length = 85 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = -3 Query: 193 DKSSDSNFNNMPIFSGILPVKWFPAKFRLCK*ERYISSSGISPDNSLLERSNDMRSGSSL 14 ++S DS+ PIF+GI P +W +F+ K R +SSSGISPDN LLERS R S L Sbjct: 2 ERSRDSSDVMAPIFTGIFPWRWLLDRFKNIKPWRSVSSSGISPDNLLLERSMPARRPSVL 61 Query: 13 SY 8 SY Sbjct: 62 SY 63