BLASTX nr result
ID: Dioscorea21_contig00031278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031278 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516403.1| pentatricopeptide repeat-containing protein,... 77 2e-12 ref|XP_003552730.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 ref|NP_193155.4| pentatricopeptide repeat-containing protein [Ar... 66 3e-09 ref|XP_003538531.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 ref|XP_002268109.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >ref|XP_002516403.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544501|gb|EEF46020.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 502 Score = 76.6 bits (187), Expect = 2e-12 Identities = 32/68 (47%), Positives = 44/68 (64%) Frame = +1 Query: 199 QHQSLLVEAYHHTNSLKTLLAELSMKNSCPIRLLERDGDWLRDQLWVAVRFLIEEGRPVD 378 +H +LLVE+YH LK LLA L+ K SCP+++L+ D DW +D W +RFL R + Sbjct: 56 KHNTLLVESYHEHQRLKALLARLNKKGSCPLQMLQDDADWSKDHFWAVIRFLRHSSRSDE 115 Query: 379 ALKVFDAW 402 L+VFD W Sbjct: 116 ILQVFDMW 123 >ref|XP_003552730.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Glycine max] Length = 509 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/70 (44%), Positives = 43/70 (61%) Frame = +1 Query: 193 ERQHQSLLVEAYHHTNSLKTLLAELSMKNSCPIRLLERDGDWLRDQLWVAVRFLIEEGRP 372 + +H +LLVE YH +SL+ LLA+L ++ P+ +L DGDW +D W VRFL R Sbjct: 58 DTKHTTLLVETYHLHDSLRALLAKLQKEDCNPLHVLAEDGDWSKDHFWAVVRFLKSASRF 117 Query: 373 VDALKVFDAW 402 L+VFD W Sbjct: 118 TQILQVFDMW 127 >ref|NP_193155.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635638|sp|O23278.2|PP310_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g14190, chloroplastic; Flags: Precursor gi|332657991|gb|AEE83391.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 501 Score = 66.2 bits (160), Expect = 3e-09 Identities = 39/99 (39%), Positives = 52/99 (52%) Frame = +1 Query: 106 TTLAMPRVHSNLSLSKNLAAGGIEDCDEQERQHQSLLVEAYHHTNSLKTLLAELSMKNSC 285 T+ ++PR S+L S L+ G Q SLL HH L +L LS+ SC Sbjct: 34 TSYSIPRP-SSLRRSLPLSING------DATQPTSLL----HHHRFLSSLTRRLSLSGSC 82 Query: 286 PIRLLERDGDWLRDQLWVAVRFLIEEGRPVDALKVFDAW 402 P+RLL+ DGDW +D W +RFL + R + L VFD W Sbjct: 83 PLRLLQEDGDWSKDHFWAVIRFLRQSSRLHEILPVFDTW 121 >ref|XP_003538531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Glycine max] Length = 506 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/70 (42%), Positives = 41/70 (58%) Frame = +1 Query: 193 ERQHQSLLVEAYHHTNSLKTLLAELSMKNSCPIRLLERDGDWLRDQLWVAVRFLIEEGRP 372 + +H +LLVE YH +SL+ LLA+L + S P+ +L D DW +D W VRFL Sbjct: 56 DTKHTTLLVETYHLHHSLRALLAKLENEYSNPLHMLAEDADWSKDHFWAVVRFLKSSSNF 115 Query: 373 VDALKVFDAW 402 L+VFD W Sbjct: 116 THILQVFDMW 125 >ref|XP_002268109.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Vitis vinifera] Length = 581 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/68 (41%), Positives = 38/68 (55%) Frame = +1 Query: 199 QHQSLLVEAYHHTNSLKTLLAELSMKNSCPIRLLERDGDWLRDQLWVAVRFLIEEGRPVD 378 +H +LLVE H L L+ +LS K S P++LL DGDW + W +RFL + R + Sbjct: 88 KHTTLLVETLHENERLGVLIQKLSNKASSPLQLLRDDGDWNKQHFWAVIRFLKDASRSSE 147 Query: 379 ALKVFDAW 402 L VF W Sbjct: 148 ILPVFHLW 155