BLASTX nr result
ID: Dioscorea21_contig00031170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031170 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001148476.1| inhibitor of apoptosis-like protein [Zea may... 60 2e-07 tpg|DAA38010.1| TPA: putative RING zinc finger domain superfamil... 57 2e-06 ref|XP_002511385.1| ATP binding protein, putative [Ricinus commu... 57 2e-06 gb|AEO33204.1| hypothetical protein [Amblyomma maculatum] 56 3e-06 ref|XP_002453251.1| hypothetical protein SORBIDRAFT_04g002540 [S... 56 3e-06 >ref|NP_001148476.1| inhibitor of apoptosis-like protein [Zea mays] gi|195619650|gb|ACG31655.1| inhibitor of apoptosis-like protein [Zea mays] Length = 326 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -1 Query: 104 CKSCHGNESSVLLLPCRHLCICVDCCLGVDVCPV 3 C+SC G E+SVLLLPCRHLC+C C GVD CPV Sbjct: 279 CRSCGGGEASVLLLPCRHLCLCPACEAGVDACPV 312 >tpg|DAA38010.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Length = 330 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -1 Query: 104 CKSCHGNESSVLLLPCRHLCICVDCCLGVDVCPV 3 C+SC E+SVLLLPCRHLC+C C GVD CPV Sbjct: 283 CRSCGAGEASVLLLPCRHLCLCRACEAGVDACPV 316 >ref|XP_002511385.1| ATP binding protein, putative [Ricinus communis] gi|223550500|gb|EEF51987.1| ATP binding protein, putative [Ricinus communis] Length = 301 Score = 56.6 bits (135), Expect = 2e-06 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = -1 Query: 107 LCKSCHGNESSVLLLPCRHLCICVDCCLGVDVCPV 3 +C++C E+S+LLLPCRHLC+C DC VD CP+ Sbjct: 253 VCRACKTKEASILLLPCRHLCLCKDCAGSVDACPI 287 >gb|AEO33204.1| hypothetical protein [Amblyomma maculatum] Length = 256 Score = 56.2 bits (134), Expect = 3e-06 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -1 Query: 110 QLCKSCHGNESSVLLLPCRHLCICVDCCLGVDVCPV 3 +LC+SC +E SVLLLPCRHLC+C C D CP+ Sbjct: 213 KLCRSCSVHEPSVLLLPCRHLCLCTTCARATDTCPI 248 >ref|XP_002453251.1| hypothetical protein SORBIDRAFT_04g002540 [Sorghum bicolor] gi|241933082|gb|EES06227.1| hypothetical protein SORBIDRAFT_04g002540 [Sorghum bicolor] Length = 343 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = -1 Query: 113 LQLCKSCHGNESSVLLLPCRHLCICVDCCLGVDVCPV 3 L C+ C G E+SVL++PCRHLC+C+DC DVCPV Sbjct: 293 LGACRWCGGKEASVLVMPCRHLCLCIDCERVSDVCPV 329