BLASTX nr result
ID: Dioscorea21_contig00031085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031085 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002506857.1| solute carrier family 19 [Micromonas sp. RCC... 67 1e-09 ref|XP_002972072.1| hypothetical protein SELMODRAFT_441668 [Sela... 59 5e-07 ref|XP_002972615.1| hypothetical protein SELMODRAFT_441875 [Sela... 59 5e-07 ref|XP_002780508.1| conserved hypothetical protein [Perkinsus ma... 57 2e-06 emb|CCO16277.1| conserved hypothetical protein [Bathycoccus pras... 57 2e-06 >ref|XP_002506857.1| solute carrier family 19 [Micromonas sp. RCC299] gi|226522130|gb|ACO68115.1| solute carrier family 19 [Micromonas sp. RCC299] Length = 542 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/71 (43%), Positives = 45/71 (63%) Frame = -3 Query: 229 LAVLLGYSFSSQFIPVEPYLVPYLTSVKGFSNYQITLDIYPISVYAQLVFTLLLAPACFY 50 LA + ++F P EP++VPYLT VKGF+N + DI+P+S+YA LVF L+ P Sbjct: 19 LAHVCAFAFLLHLKPSEPHIVPYLTDVKGFTNESVANDIFPVSIYASLVFYLVAGPVSRR 78 Query: 49 LSHKAVIILGA 17 + K ++LGA Sbjct: 79 IGLKTFVLLGA 89 >ref|XP_002972072.1| hypothetical protein SELMODRAFT_441668 [Selaginella moellendorffii] gi|300160371|gb|EFJ26989.1| hypothetical protein SELMODRAFT_441668 [Selaginella moellendorffii] Length = 448 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 2/76 (2%) Frame = -3 Query: 229 LAVLL--GYSFSSQFIPVEPYLVPYLTSVKGFSNYQITLDIYPISVYAQLVFTLLLAPAC 56 LAVLL Y F+ +F PV PY V Y+ KG +N +I+ I P+ VY++ +F L APAC Sbjct: 26 LAVLLPSAYRFAQRFAPVIPYEVRYMIHNKGITNQEISTRILPVGVYSRSLFIFLAAPAC 85 Query: 55 FYLSHKAVIILGAFGL 8 S+ ++L + + Sbjct: 86 SLFSYHGTLMLASLAV 101 >ref|XP_002972615.1| hypothetical protein SELMODRAFT_441875 [Selaginella moellendorffii] gi|300160082|gb|EFJ26701.1| hypothetical protein SELMODRAFT_441875 [Selaginella moellendorffii] Length = 448 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 2/76 (2%) Frame = -3 Query: 229 LAVLL--GYSFSSQFIPVEPYLVPYLTSVKGFSNYQITLDIYPISVYAQLVFTLLLAPAC 56 LAVLL Y F+ +F PV PY V Y+ KG +N +I+ I P+ VY++ +F L APAC Sbjct: 26 LAVLLPSAYRFAQRFAPVIPYEVRYMIHNKGITNQEISTRILPVGVYSRSLFIFLAAPAC 85 Query: 55 FYLSHKAVIILGAFGL 8 S+ ++L + + Sbjct: 86 SLFSYHGTLMLASLAV 101 >ref|XP_002780508.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] gi|239890442|gb|EER12303.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] Length = 487 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/64 (46%), Positives = 39/64 (60%) Frame = -3 Query: 193 FIPVEPYLVPYLTSVKGFSNYQITLDIYPISVYAQLVFTLLLAPACFYLSHKAVIILGAF 14 FIP EP+L YL VKGF++ QI IYP S YA + F L+ ++ +K +ILGA Sbjct: 89 FIPSEPHLTTYLREVKGFTDDQINSQIYPWSTYACIPFLLVGGCLSEFVGYKLALILGAM 148 Query: 13 GLLA 2 G LA Sbjct: 149 GRLA 152 >emb|CCO16277.1| conserved hypothetical protein [Bathycoccus prasinos] Length = 549 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/58 (48%), Positives = 36/58 (62%) Frame = -3 Query: 235 SLLAVLLGYSFSSQFIPVEPYLVPYLTSVKGFSNYQITLDIYPISVYAQLVFTLLLAP 62 SLL +L + F F P EP+LVPYL KGFS +I +I+P+ VYA +TLL P Sbjct: 15 SLLVILCSFCFFFWFKPSEPFLVPYLVHTKGFSIREINEEIFPVYVYAFFAWTLLSGP 72