BLASTX nr result
ID: Dioscorea21_contig00031014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00031014 (537 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144685.1| PREDICTED: uncharacterized protein LOC101208... 90 2e-16 tpg|DAA57164.1| TPA: hypothetical protein ZEAMMB73_082056 [Zea m... 88 7e-16 ref|XP_002456517.1| hypothetical protein SORBIDRAFT_03g037690 [S... 87 1e-15 ref|XP_002530965.1| conserved hypothetical protein [Ricinus comm... 87 2e-15 ref|XP_002319207.1| predicted protein [Populus trichocarpa] gi|2... 85 8e-15 >ref|XP_004144685.1| PREDICTED: uncharacterized protein LOC101208481 [Cucumis sativus] Length = 1585 Score = 90.1 bits (222), Expect = 2e-16 Identities = 41/69 (59%), Positives = 56/69 (81%) Frame = -3 Query: 208 RKGLMMSIRTSYKFAKDYPFVSGLVFFMLSLYRCFPSLFAFLISSSPVIFCTAVLLGLLL 29 RK +++SIRT Y+ ++YPF+ GL+ F++ LYR P LF+ L+S+SPV+ CTAVLLG LL Sbjct: 8 RKFVVVSIRTCYRSVRNYPFLFGLLCFLILLYRSCPFLFSLLVSASPVLICTAVLLGTLL 67 Query: 28 SYGEPNIPE 2 SYG+PNIPE Sbjct: 68 SYGQPNIPE 76 >tpg|DAA57164.1| TPA: hypothetical protein ZEAMMB73_082056 [Zea mays] Length = 1016 Score = 88.2 bits (217), Expect = 7e-16 Identities = 43/81 (53%), Positives = 57/81 (70%) Frame = -3 Query: 244 MAIEMKKVLLFTRKGLMMSIRTSYKFAKDYPFVSGLVFFMLSLYRCFPSLFAFLISSSPV 65 MA+E K+ L ++ L +SIR SY+F ++P + GL F+ YR P LF FL+SSSPV Sbjct: 1 MALEAKQAALCFKEVLRLSIRKSYRFVSEHPILFGLGVFLYLFYRSSPRLFVFLLSSSPV 60 Query: 64 IFCTAVLLGLLLSYGEPNIPE 2 CTA+LLG+LLSYGE N+PE Sbjct: 61 NICTALLLGILLSYGEVNLPE 81 >ref|XP_002456517.1| hypothetical protein SORBIDRAFT_03g037690 [Sorghum bicolor] gi|241928492|gb|EES01637.1| hypothetical protein SORBIDRAFT_03g037690 [Sorghum bicolor] Length = 1261 Score = 87.4 bits (215), Expect = 1e-15 Identities = 44/81 (54%), Positives = 56/81 (69%) Frame = -3 Query: 244 MAIEMKKVLLFTRKGLMMSIRTSYKFAKDYPFVSGLVFFMLSLYRCFPSLFAFLISSSPV 65 MA+ K+ L +K L +SIR SY F ++P + GL + LYR P LF FL+SSSPV Sbjct: 1 MALAAKQAALCFKKVLRLSIRKSYTFVSEHPVLFGLGVLLYLLYRSSPRLFVFLLSSSPV 60 Query: 64 IFCTAVLLGLLLSYGEPNIPE 2 I CTA+LLG+LLSYGE N+PE Sbjct: 61 IICTALLLGILLSYGEINLPE 81 >ref|XP_002530965.1| conserved hypothetical protein [Ricinus communis] gi|223529480|gb|EEF31437.1| conserved hypothetical protein [Ricinus communis] Length = 1204 Score = 86.7 bits (213), Expect = 2e-15 Identities = 38/81 (46%), Positives = 60/81 (74%) Frame = -3 Query: 244 MAIEMKKVLLFTRKGLMMSIRTSYKFAKDYPFVSGLVFFMLSLYRCFPSLFAFLISSSPV 65 M ++ ++ + ++ L++SIRT YK +PF+ G V F++ LY+ FP LF+ L+S+SP+ Sbjct: 1 MGLDAMRIRVEIKRFLVISIRTCYKSVCKHPFLVGFVCFLIFLYKSFPFLFSLLVSASPI 60 Query: 64 IFCTAVLLGLLLSYGEPNIPE 2 + CTA+LLG LLS+G+PNIPE Sbjct: 61 LVCTAILLGTLLSFGKPNIPE 81 >ref|XP_002319207.1| predicted protein [Populus trichocarpa] gi|222857583|gb|EEE95130.1| predicted protein [Populus trichocarpa] Length = 1661 Score = 84.7 bits (208), Expect = 8e-15 Identities = 38/81 (46%), Positives = 59/81 (72%) Frame = -3 Query: 244 MAIEMKKVLLFTRKGLMMSIRTSYKFAKDYPFVSGLVFFMLSLYRCFPSLFAFLISSSPV 65 M I+ ++ + R+ L++S + Y+ +PF+ G+V ++L LYR FP LF+ L+++SPV Sbjct: 1 MGIDAMRIRVQIRRFLVISFQLCYRSVCKHPFLVGMVCYLLLLYRSFPFLFSLLVTASPV 60 Query: 64 IFCTAVLLGLLLSYGEPNIPE 2 + CTA+LLG LLS+GEPNIPE Sbjct: 61 LICTAILLGTLLSFGEPNIPE 81