BLASTX nr result
ID: Dioscorea21_contig00030142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030142 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ96409.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 2e-06 >dbj|BAJ96409.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 791 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/67 (44%), Positives = 40/67 (59%) Frame = +3 Query: 3 KLRAFEEWSRKYSQKMTTSTSSEVSDPPTNDEIIQIDPSQERKLAVETAKSKLDSDVDAY 182 K RAFEEW K+ Q+ T DP + D Q D ER+ AVE+ KSKLD++V+A+ Sbjct: 684 KARAFEEWYHKHGQRRT------FDDPESGDGTSQKDAISERRFAVESLKSKLDNEVEAH 737 Query: 183 QKFCKKV 203 K K+V Sbjct: 738 NKLSKQV 744