BLASTX nr result
ID: Dioscorea21_contig00030013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00030013 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529498.1| ATP binding protein, putative [Ricinus commu... 62 6e-08 ref|XP_002521786.1| Disease resistance protein RPP13, putative [... 56 3e-06 gb|AAL32592.1| disease resistance protein RPP8 [Arabidopsis thal... 54 1e-05 ref|NP_199160.1| disease resistance protein RPP8 [Arabidopsis th... 54 1e-05 ref|XP_002529494.1| conserved hypothetical protein [Ricinus comm... 54 1e-05 >ref|XP_002529498.1| ATP binding protein, putative [Ricinus communis] gi|223531056|gb|EEF32908.1| ATP binding protein, putative [Ricinus communis] Length = 1394 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/56 (51%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -2 Query: 214 LKFLEINGCRRLKMIPEGLKNVP-LEVLQLNSMAEEFKNRIKENTGEDWYKIQHVP 50 L+ L+I CR+LKM+PEGL+++ L+VL++ M EF +RI+EN G DWYKI ++P Sbjct: 1334 LRELQIISCRQLKMLPEGLEHMTSLKVLKVREMPSEFTSRIQENHGLDWYKIANIP 1389 >ref|XP_002521786.1| Disease resistance protein RPP13, putative [Ricinus communis] gi|223538999|gb|EEF40596.1| Disease resistance protein RPP13, putative [Ricinus communis] Length = 929 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/55 (43%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -2 Query: 205 LEINGCRRLKMIPEGLKNVP-LEVLQLNSMAEEFKNRIKENTGEDWYKIQHVPNI 44 LEI+ C +KM+P+GL+ + L+ +++ SM + FK R++E G+D+YK+QHVP++ Sbjct: 869 LEISNCTSMKMVPDGLRFITCLQEMEIRSMLKAFKTRLEEG-GDDYYKVQHVPSV 922 >gb|AAL32592.1| disease resistance protein RPP8 [Arabidopsis thaliana] Length = 908 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/59 (40%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -2 Query: 217 CLKFLEINGCRRLKMIPEGLKNV-PLEVLQLNSMAEEFKNRIKENTGEDWYKIQHVPNI 44 CL+ L I+ C++LK +P+GLK + L+ L++ M E+K ++ GED+YK+QH+P++ Sbjct: 844 CLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPG-GEDYYKVQHIPDV 901 >ref|NP_199160.1| disease resistance protein RPP8 [Arabidopsis thaliana] gi|30694301|ref|NP_851124.1| disease resistance protein RPP8 [Arabidopsis thaliana] gi|29839585|sp|Q8W4J9.2|RPP8_ARATH RecName: Full=Disease resistance protein RPP8; AltName: Full=Resistance to Peronospora parasitica protein 8 gi|3901294|gb|AAC78631.1| rpp8 [Arabidopsis thaliana] gi|8843900|dbj|BAA97426.1| disease resistance protein RPP8 [Arabidopsis thaliana] gi|332007584|gb|AED94967.1| disease resistance protein RPP8 [Arabidopsis thaliana] gi|332007585|gb|AED94968.1| disease resistance protein RPP8 [Arabidopsis thaliana] Length = 908 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/59 (40%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -2 Query: 217 CLKFLEINGCRRLKMIPEGLKNV-PLEVLQLNSMAEEFKNRIKENTGEDWYKIQHVPNI 44 CL+ L I+ C++LK +P+GLK + L+ L++ M E+K ++ GED+YK+QH+P++ Sbjct: 844 CLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPG-GEDYYKVQHIPDV 901 >ref|XP_002529494.1| conserved hypothetical protein [Ricinus communis] gi|223531052|gb|EEF32904.1| conserved hypothetical protein [Ricinus communis] Length = 1115 Score = 54.3 bits (129), Expect = 1e-05 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = -2 Query: 214 LKFLEINGCRRLKMIPEGLKNVP-LEVLQLNSMAEEFKNRIKENTGEDWYKIQHVPNISI 38 LK LEI CR L M+P+GL++V L L+L +M RIK+N GEDW K+ H+ NI I Sbjct: 1055 LKCLEIRSCRNLGMLPDGLQHVKTLSKLKLTNMPM-LSARIKDNEGEDWDKVAHILNIYI 1113 Query: 37 K 35 + Sbjct: 1114 E 1114