BLASTX nr result
ID: Dioscorea21_contig00029473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00029473 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145672.1| PREDICTED: uncharacterized RNA methyltransfe... 40 8e-07 ref|NP_189354.2| S-adenosylmethionine-dependent methyltransferas... 41 1e-06 ref|XP_002877022.1| hypothetical protein ARALYDRAFT_904929 [Arab... 41 1e-06 dbj|BAB01935.1| unnamed protein product [Arabidopsis thaliana] 41 1e-06 >ref|XP_004145672.1| PREDICTED: uncharacterized RNA methyltransferase pc1998-like [Cucumis sativus] Length = 519 Score = 39.7 bits (91), Expect(2) = 8e-07 Identities = 21/36 (58%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -3 Query: 240 GMTCCAKLII*ASPDSLLIGLCQEGCHNIVDIP-CK 136 G C AKL + S S +IGL QEG HN+VDIP CK Sbjct: 105 GWRCRAKLAVRGSSISPMIGLYQEGTHNVVDIPDCK 140 Score = 38.1 bits (87), Expect(2) = 8e-07 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 356 CWSCLHELALDWSSVLQEVSNFFEDHEAWDFNFESSLLWG 237 C C HE L +++E + FF D DF F+S LWG Sbjct: 66 CSGCTHEFDLHRPVIVEEATQFFNDLGVLDFTFDSCKLWG 105 >ref|NP_189354.2| S-adenosylmethionine-dependent methyltransferase-domain containing protein [Arabidopsis thaliana] gi|190341123|gb|ACE74720.1| At3g27180 [Arabidopsis thaliana] gi|332643755|gb|AEE77276.1| S-adenosylmethionine-dependent methyltransferase-domain containing protein [Arabidopsis thaliana] Length = 518 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 21/36 (58%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -3 Query: 240 GMTCCAKLII*ASPDSLLIGLCQEGCHNIVDIP-CK 136 G C AKL + S D+ LIGL QEG H +VDIP CK Sbjct: 95 GWRCRAKLAVRGSSDNALIGLYQEGTHTVVDIPECK 130 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -1 Query: 356 CWSCLHELALDWSSVLQEVSNFFEDHEAWDFNFESSLLWG 237 C C E L +V+ E S+FF+ + DF F+S LWG Sbjct: 56 CSGCTQEFNLHRPAVVDEASDFFKRYGVDDFTFDSCRLWG 95 >ref|XP_002877022.1| hypothetical protein ARALYDRAFT_904929 [Arabidopsis lyrata subsp. lyrata] gi|297322860|gb|EFH53281.1| hypothetical protein ARALYDRAFT_904929 [Arabidopsis lyrata subsp. lyrata] Length = 512 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 21/36 (58%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -3 Query: 240 GMTCCAKLII*ASPDSLLIGLCQEGCHNIVDIP-CK 136 G C AKL + S D+ LIGL QEG H +VDIP CK Sbjct: 94 GWRCRAKLAVRGSSDNALIGLYQEGTHTVVDIPECK 129 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 356 CWSCLHELALDWSSVLQEVSNFFEDHEAWDFNFESSLLWG 237 C C E L +V+ E S FF+ + DF F+S LWG Sbjct: 55 CSGCTQEFNLHRPAVVDEASGFFKRYGVEDFTFDSCRLWG 94 >dbj|BAB01935.1| unnamed protein product [Arabidopsis thaliana] Length = 511 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 21/36 (58%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -3 Query: 240 GMTCCAKLII*ASPDSLLIGLCQEGCHNIVDIP-CK 136 G C AKL + S D+ LIGL QEG H +VDIP CK Sbjct: 94 GWRCRAKLAVRGSSDNALIGLYQEGTHTVVDIPECK 129 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -1 Query: 356 CWSCLHELALDWSSVLQEVSNFFEDHEAWDFNFESSLLWG 237 C C E L +V+ E S+FF+ + DF F+S LWG Sbjct: 55 CSGCTQEFNLHRPAVVDEASDFFKRYGVDDFTFDSCRLWG 94