BLASTX nr result
ID: Dioscorea21_contig00029152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00029152 (603 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ89569.1| predicted protein [Hordeum vulgare subsp. vulgare] 47 1e-06 >dbj|BAJ89569.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 135 Score = 47.4 bits (111), Expect(2) = 1e-06 Identities = 19/36 (52%), Positives = 28/36 (77%) Frame = -2 Query: 440 NFGKRLGLLFAGIGVLLQIGLGSFLAFKRWQLKMLE 333 NFG+RLG+ FAG+ V +Q+ LG+ LA + WQL+ L+ Sbjct: 89 NFGERLGIAFAGVAVAMQVVLGALLALRAWQLRRLD 124 Score = 30.8 bits (68), Expect(2) = 1e-06 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = -3 Query: 538 ALPARIATMR---PASPSATPHQGHHHHH 461 A P R+A+ PA P PH HHHHH Sbjct: 48 APPRRVASDSDGAPAPPHHPPHHHHHHHH 76