BLASTX nr result
ID: Dioscorea21_contig00029121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00029121 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001177077.1| Os12g0635400 [Oryza sativa Japonica Group] g... 60 1e-07 gb|EAY84023.1| hypothetical protein OsI_39255 [Oryza sativa Indi... 60 1e-07 dbj|BAK08227.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 4e-07 dbj|BAK00863.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 4e-07 ref|XP_003575762.1| PREDICTED: uncharacterized protein LOC100832... 59 5e-07 >ref|NP_001177077.1| Os12g0635400 [Oryza sativa Japonica Group] gi|255670515|dbj|BAH95805.1| Os12g0635400 [Oryza sativa Japonica Group] Length = 111 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 5/45 (11%) Frame = -3 Query: 121 IHTVRKPPSKPWRR-----PEPAPAKVYRVEPRGFRQLVQRLTGS 2 + V+KPP+KPWR P PAP KVYRVEPR FR LVQRLTG+ Sbjct: 17 LRAVQKPPAKPWRASPSAAPGPAPPKVYRVEPREFRDLVQRLTGA 61 >gb|EAY84023.1| hypothetical protein OsI_39255 [Oryza sativa Indica Group] Length = 111 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 5/45 (11%) Frame = -3 Query: 121 IHTVRKPPSKPWRR-----PEPAPAKVYRVEPRGFRQLVQRLTGS 2 + V+KPP+KPWR P PAP KVYRVEPR FR LVQRLTG+ Sbjct: 17 LRAVQKPPAKPWRASPSAAPGPAPPKVYRVEPREFRDLVQRLTGA 61 >dbj|BAK08227.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 128 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 7/47 (14%) Frame = -3 Query: 121 IHTVRKPPSKPWRR-------PEPAPAKVYRVEPRGFRQLVQRLTGS 2 + +V+KPP+KPWR P P P KVYRVEPR FR LVQRLTG+ Sbjct: 22 LRSVQKPPAKPWRAGGGLTPAPAPTPPKVYRVEPREFRDLVQRLTGA 68 >dbj|BAK00863.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 128 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 7/47 (14%) Frame = -3 Query: 121 IHTVRKPPSKPWRR-------PEPAPAKVYRVEPRGFRQLVQRLTGS 2 + +V+KPP+KPWR P P P KVYRVEPR FR LVQRLTG+ Sbjct: 22 LRSVQKPPAKPWRAGGGLTPAPAPTPPKVYRVEPREFRDLVQRLTGA 68 >ref|XP_003575762.1| PREDICTED: uncharacterized protein LOC100832884 [Brachypodium distachyon] Length = 137 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 8/48 (16%) Frame = -3 Query: 121 IHTVRKPPSKPWRR--------PEPAPAKVYRVEPRGFRQLVQRLTGS 2 + V+KPP+KPWR P PAP +VYRVEPR FR LVQRLTG+ Sbjct: 27 LRAVQKPPAKPWRAAASSSSSSPAPAPPRVYRVEPREFRDLVQRLTGA 74